PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G040800.1
Common NamePOPTR_0019s05730g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 227aa    MW: 25005.9 Da    PI: 6.6293
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G040800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.71.2e-152484257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l    ++ +++V++WFqNrR + ++
  Potri.019G040800.1 24 RSRWTPKPEQILILESIFNSgMVNPPKNETVRIRKLLekfgSVGDANVFYWFQNRRSRSRR 84
                        89*****************99*************************************997 PP

2Wus_type_Homeobox106.81.4e-342386265
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G ++d+NVfyWFQNr++R+r++q
  Potri.019G040800.1 23 VRSRWTPKPEQILILESIFNSGMVNPPKNETVRIRKLLEKFGSVGDANVFYWFQNRRSRSRRRQ 86
                        589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.27E-141991IPR009057Homeodomain-like
PROSITE profilePS5007111.372085IPR001356Homeobox domain
SMARTSM003892.2E-62289IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.8E-92389IPR009057Homeodomain-like
PfamPF000462.2E-132484IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MEDNQGQDHN SQSNHGTERS EPVRSRWTPK PEQILILESI FNSGMVNPPK NETVRIRKLL  60
EKFGSVGDAN VFYWFQNRRS RSRRRQRQMQ ASGGTSNGFA NSPSSYLVGA SSSCGVVGED  120
HGVESLFSFS NQMGFQEFEQ TSGVTSIVCP SETSSLHYQT AGFITIFING VPTEVPRVPL  180
DVKAMFGQDV MLVHSSGVPV PTNEFGFLVQ ILHHGESYFL VNISAV*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.019G040800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827110.0KF982711.1 Populus tomentosa WOX11/12b (WOX11/12b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024446658.11e-148WUSCHEL-related homeobox 11
SwissprotQ6X7J38e-69WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLA0A3N7HC831e-146A0A3N7HC83_POPTR; Uncharacterized protein
STRINGPOPTR_0019s05730.11e-166(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58983152
Representative plantOGRP46971222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.12e-70WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]
  2. Sheng L, et al.
    Non-canonical WOX11-mediated root branching contributes to plasticity in Arabidopsis root system architecture.
    Development, 2017. 144(17): p. 3126-3133
    [PMID:28743799]
  3. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]
  4. Baesso B, et al.
    Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana.
    Plant Biol (Stuttg), 2018. 20(3): p. 426-432
    [PMID:29450949]