PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G021400.1
Common NamePOPTR_0019s03790g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 133aa    MW: 14827.7 Da    PI: 8.7337
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G021400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer91.76.5e-291972458
         ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                        ++Y+eC +NhA+ +GghavDGCgEf+p+ g++gt++a+ C ACgCHRnFHR++v 
  Potri.019G021400.1 19 AEYRECWRNHAILTGGHAVDGCGEFTPN-GDQGTKEAFICEACGCHRNFHRKQVI 72
                        58*************************8.9999*******************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.2E-272070IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.2E-252070IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-162188IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.5892170IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MANSDSKSKP LNEESRIIAE YRECWRNHAI LTGGHAVDGC GEFTPNGDQG TKEAFICEAC  60
GCHRNFHRKQ VIMRDGTILL DTHHSPPPPY ELYGAPYTSV SDEESLYNGS SSEKKMKARK  120
RPKRGTAMRN KK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.019G021400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325346.17e-97zinc-finger homeodomain protein 2
TrEMBLB9IPC12e-95B9IPC1_POPTR; Uncharacterized protein
STRINGPOPTR_0019s03790.13e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1711168
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.17e-24homeobox protein 21