PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G020900.6
Common NamePOPTR_0019s03750g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 284aa    MW: 31202.5 Da    PI: 6.231
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G020900.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.85.8e-34200254155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k r+rWtpeLHe+Fveav+qLGGse+AtPk +l+ m+v+gLt++hvkSHLQkYR+
  Potri.019G020900.6 200 KSRMRWTPELHEAFVEAVNQLGGSERATPKGVLKQMNVEGLTIYHVKSHLQKYRT 254
                         68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.489197257IPR017930Myb domain
SuperFamilySSF466891.16E-18198254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-31199256IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-25200254IPR006447Myb domain, plants
PfamPF002499.2E-11202253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MIRNPASQQA SPLSSGNGSV GHLVSSSSRF TNDTSVSAVS PQGKQSHNSP FISQSLRDGG  60
NFPPTHYSHS EGQSTAFINH SDDNKGLSWP IDPLQEFINF VENVPVQNGQ VESTAGVIAS  120
EDHAKRTDWQ EWADQLISVD DELEPNWSEI LNDVNMKDSK QKMLSPNNSV QQPLIHQHQT  180
AHSGEVCAVT NPLLAAPPTK SRMRWTPELH EAFVEAVNQL GGSERATPKG VLKQMNVEGL  240
TIYHVKSHLQ KYRTARYKPE SSEGTSEKKL SPVEEMKSLD LKT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-32200258260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-32200258260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-32200258260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-32200258260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-32200258260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-32200258260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-32200258260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-32200258260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots. {ECO:0000269|PubMed:20838596}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.019G020900.6
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024447350.10.0protein PHR1-LIKE 1 isoform X1
SwissprotQ8GUN54e-69PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A2K1WN810.0A0A2K1WN81_POPTR; Uncharacterized protein
STRINGPOPTR_0019s03750.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.31e-71G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]