PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G011500.1
Common NamePOPTR_0019s02540g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 259aa    MW: 29679.2 Da    PI: 4.5673
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G011500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS178.74.3e-551223976308
                GRAS  76 eelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLa 166
                          +++++++++e+sP++kf+h+taNqaIle+++g++++HiiDfdi++G+QWp+L+  L+ R++   s+++T++   ++++  ++++tg+rL+
  Potri.019G011500.1  12 YNMSSFQVLQELSPCVKFAHFTANQAILESTQGDQEIHIIDFDIMEGIQWPPLMVDLTMRKDV--SFKVTAIIG-DQQDVAAVQQTGRRLK 99 
                         567899*****************************************************9655..9*****988.55799*********** PP

                GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe....adhnsesF 253
                         ++A+++++ f f+ +    l++ ++e++  + g +l+Vn++++  +++++s s+ +   ++L  v +l Pk+vv+ve+e     +    s+
  Potri.019G011500.1 100 EYADSINLLFVFEQM--MMLNEEDFESI--EMGQTLVVNCMIHQLHMPNRSFSSIK---TFLGGVSRLTPKLVVLVEEElfsfYKFPYMSY 183
                         *************95..33455555655..4599********99999988888877...********************654334466799 PP

                GRAS 254 lerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrer 308
                         +e f+ea+++y++l dsl ++ l++++ e + +E+e+lg +iv+ v++   +++er
  Potri.019G011500.1 184 VEFFCEAIHHYTTLSDSLvSSFLSANEMELRLIEKEYLGVKIVDSVSQLPCKKKER 239
                         9*****************89999999999*****************9888887777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098529.0761258IPR005202Transcription factor GRAS
PfamPF035141.5E-5212239IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MLLPRPGYRQ QYNMSSFQVL QELSPCVKFA HFTANQAILE STQGDQEIHI IDFDIMEGIQ  60
WPPLMVDLTM RKDVSFKVTA IIGDQQDVAA VQQTGRRLKE YADSINLLFV FEQMMMLNEE  120
DFESIEMGQT LVVNCMIHQL HMPNRSFSSI KTFLGGVSRL TPKLVVLVEE ELFSFYKFPY  180
MSYVEFFCEA IHHYTTLSDS LVSSFLSANE MELRLIEKEY LGVKIVDSVS QLPCKKKERL  240
LWEEGFASLN DGILGTPE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-221722980296GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006371003.11e-180hypothetical protein POPTR_0019s02540g
TrEMBLU5FEG11e-180U5FEG1_POPTR; Uncharacterized protein
STRINGPOPTR_0019s02540.11e-179(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8945915
FabidsOGEF131482130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.19e-37GRAS family protein