PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G011200.1
Common NamePOPTR_0019s02540g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 486aa    MW: 55233.2 Da    PI: 4.5148
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G011200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS252.31.8e-771204792373
                GRAS   2 velLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                         ++lLl  Aeav++++ +l ++++a+l++l     + g++++Rla +ft++L+ +     +e+   l p++    +++ +++++++++e+sP
  Potri.019G011200.1 120 TDLLLMGAEAVEAQNWTLSSNIIAKLRNLlldGENGGSSFNRLALFFTQGLHYKSIT-APEM---LLPRPGY--RQQYNMSSFQVLQELSP 204
                         689999**********************9884455569*************988776.2333...3444443..467788999******** PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                         ++kf+h+taNqaIle+++g++++HiiDfdi++G+QWp+L+  L+ R++   s+++T++   ++++  ++++tg+rL+++A+++++pf f+ 
  Potri.019G011200.1 205 CVKFAHFTANQAILESTQGDQEIHIIDFDIMEGIQWPPLMVDLTMRKDV--SFKVTAIIG-DQQDVAAVQQTGRRLKEYADSINLPFVFKQ 292
                         *********************************************9655..9*****988.55799************************9 PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe....adhnsesFlerflealeyysal 267
                         +    l++ ++e++  + g al+Vn++++  +++++s s+ +   ++L  v +lsPk+vv+ve+e     +    s++e f+ea+++y++l
  Potri.019G011200.1 293 M--MMLNEEDFESI--EMGQALVVNCMIHQLHMPNRSFSSIK---TFLGGVSRLSPKLVVLVEEElfsfYKFPYMSYVEFFCEAIHHYTTL 376
                         5..33445555655..4599********99999988888877...********************6543344667999************* PP

                GRAS 268 fdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee.aGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                          dsl ++ l++++ e + +E+e+lg +iv+ v++   +++er      W+e + +  GFkpvpls+ +++qa+ l++ ++++ + v++e+ 
  Potri.019G011200.1 377 SDSLvSSFLSANEMELRLIEKEYLGVKIVDSVSQFPCKKKERLL----WEEGFASlKGFKPVPLSSCNVSQANFLVSLFSGR-FWVQHEKC 462
                         ****89999999999***********************888887....****98868***********************88.******** PP

                GRAS 357 slvlgWkdrpLvsvSaW 373
                          l l+Wk+rpL+++S W
  Potri.019G011200.1 463 RLSLCWKSRPLTTASIW 479
                         ***************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.72793461IPR005202Transcription factor GRAS
PfamPF035146.3E-75120479IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MEFEQLHHSI KPGSTQSIHE FSLESVFSLQ TEDSIVLSAI QDDALYDDCM ERLLEIETEL  60
MDFSSMTQDN VICLESSDDV LFELGHDMIQ ETTGDVSLLK EENSLLKGIH EELLDDSSLT  120
DLLLMGAEAV EAQNWTLSSN IIAKLRNLLL DGENGGSSFN RLALFFTQGL HYKSITAPEM  180
LLPRPGYRQQ YNMSSFQVLQ ELSPCVKFAH FTANQAILES TQGDQEIHII DFDIMEGIQW  240
PPLMVDLTMR KDVSFKVTAI IGDQQDVAAV QQTGRRLKEY ADSINLPFVF KQMMMLNEED  300
FESIEMGQAL VVNCMIHQLH MPNRSFSSIK TFLGGVSRLS PKLVVLVEEE LFSFYKFPYM  360
SYVEFFCEAI HHYTTLSDSL VSSFLSANEM ELRLIEKEYL GVKIVDSVSQ FPCKKKERLL  420
WEEGFASLKG FKPVPLSSCN VSQANFLVSL FSGRFWVQHE KCRLSLCWKS RPLTTASIWV  480
PKSEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3514347924374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006371003.10.0hypothetical protein POPTR_0019s02540g
TrEMBLU5FEG10.0U5FEG1_POPTR; Uncharacterized protein
STRINGPOPTR_0019s02540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8945915
FabidsOGEF131482130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-52GRAS family protein