PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G010200.1
Common NamePOPTR_0019s02650g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 497aa    MW: 56887.8 Da    PI: 5.022
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G010200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix90.51.8e-2842125186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+kqe+laL+e+r++m+ ++r++  k+plWeevs+k+ e g++rs+k+Ckek+en+ k+++++k ++++r  ++ +t+++f+ql+
  Potri.019G010200.1  42 RWPKQETLALLEIRSDMDVAFRDSVVKAPLWEEVSRKLNELGYNRSAKKCKEKFENIYKYHRRTKGSQSGR--PNGKTYRFFEQLQ 125
                         8********************************************************************97..55568******98 PP

2trihelix104.76.8e-33333418187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k+e+  Li++r+++e +++++  k+plWee+s  m+  g+ rs+k+Ckekwen+nk++k++k+++kkr +++s+tcpyf+ql+a
  Potri.019G010200.1 333 RWPKEEIESLIKIRTYLEFQYQENGPKGPLWEEISTSMKNLGYDRSAKRCKEKWENMNKYFKRVKDSNKKR-PGDSKTCPYFQQLDA 418
                         8*********************************************************************8.9************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.1E-439101IPR001005SANT/Myb domain
CDDcd122036.50E-2341106No hitNo description
PfamPF138371.2E-1941127No hitNo description
PROSITE profilePS500907.2134199IPR017877Myb-like domain
PROSITE profilePS500907.538326390IPR017877Myb-like domain
SMARTSM007170.13330392IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-4331390IPR009057Homeodomain-like
PfamPF138374.1E-23332419No hitNo description
CDDcd122034.51E-26332397No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MEASTTFLEN SSAAAGDWED EEGDEGMRVQ AEEGVQCSTA NRWPKQETLA LLEIRSDMDV  60
AFRDSVVKAP LWEEVSRKLN ELGYNRSAKK CKEKFENIYK YHRRTKGSQS GRPNGKTYRF  120
FEQLQALDKT NALVSPTSSD KDHCLMPSAS VIPVSFIPND VPCSVQSPRM NCTDATSTST  180
ASTSSEESEG TRKKKRRLTD FFERLMKEVI EKQENLQNKF LEAIEKCEQE RIAREEVWKM  240
QELDRIKREQ ELLVHERAIA AAKDAAVLAF LQKFSEQGIP VQLPDNPTVP MKFPDNQTSP  300
ALLSKNQAVP VENVVKTHEN SSVESFVNMS SSRWPKEEIE SLIKIRTYLE FQYQENGPKG  360
PLWEEISTSM KNLGYDRSAK RCKEKWENMN KYFKRVKDSN KKRPGDSKTC PYFQQLDALY  420
REKTRRVDNP SYELKPEELL MHMMGGQEDQ QLPDSATTED RESENVDQIQ VDYRGKEDGD  480
GYGIVAIDPS SLEIME*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192196KKKRR
2192197KKKRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2113060.0AC211306.1 Populus trichocarpa clone POP004-K18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006371015.10.0hypothetical protein POPTR_0019s02650g, partial
SwissprotQ391171e-121TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLU5FHB50.0U5FHB5_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0019s02650.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.24e-66Trihelix family protein