PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G006600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 194aa    MW: 21538.4 Da    PI: 4.6658
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G006600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix591.2e-184293152
            trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCke 52
                        rW+kqe+laL+e+r++m+ ++r++  k+plWeevs+k+ e g++rs+k+C+e
  Potri.019G006600.1 42 RWPKQETLALLEIRSDMDVAFRDSVVKAPLWEEVSRKLNELGYNRSAKKCQE 93
                        8*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122033.00E-194193No hitNo description
PfamPF138378.9E-114193No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MEASTTFLEN SSAAAGDWED EEGDEGMRVQ AEEGVQCSTA NRWPKQETLA LLEIRSDMDV  60
AFRDSVVKAP LWEEVSRKLN ELGYNRSAKK CQENKGIVAI DPSSMEIMES LDNEFLSTAK  120
LSLPYSEMPP ILKLGRKMLS TSVPQARHLC VTFLILESFT AANWCCRGDH GREKWTLLLK  180
GVCEGQSSDS AKR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2113061e-126AC211306.1 Populus trichocarpa clone POP004-K18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ391176e-22TGT2_ARATH; Trihelix transcription factor GT-2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.23e-23Trihelix family protein