PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G151400.1
Common NamePOPTR_0018s14830g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 452aa    MW: 49793.2 Da    PI: 6.7036
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G151400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.6e-31239293155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt+eLH+ Fv+av++LGG+++AtPk+il +m+vkgL+++hvkSHLQkYRl
  Potri.018G151400.1 239 KQRIRWTTELHDLFVDAVKSLGGPDVATPKSILGIMNVKGLSIYHVKSHLQKYRL 293
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.863236296IPR017930Myb domain
SuperFamilySSF466894.12E-17236295IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-29237294IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-24239294IPR006447Myb domain, plants
PfamPF002492.7E-8243292IPR001005SANT/Myb domain
PfamPF143791.9E-15332376IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MKFYSTVKSF NRRKGAMQTH PSSLNTESVG LYCLNKNLQY SAVLPDCVQP KPPNSLPQAS  60
LFLTRTLNAS PILNDAVSYG SIGQPRKGTM FSASLQPSPL TIAESDLQLP TSPFLQRPLP  120
VDHITPPSDS LFLGGQDVIT EPENENLMGV LDECSGGSFT GLHCTKESLT STEKLVLQYL  180
SKELEIPVDD VSQNSTLNEA QRVSSIPVTE LNHNANYRSS AAQMDDSINR LPEAATSQKQ  240
RIRWTTELHD LFVDAVKSLG GPDVATPKSI LGIMNVKGLS IYHVKSHLQK YRLAKKFPET  300
NHDKSTSTVV ENKAASSNSN NDALVIESNR DVQVTEALRT QIEIQKLLHE QLKAQKELQI  360
RIEQNEKFLR ELMEQKAISI YEPSSFAVPA SEPKLLPHSP SADVSSPGQA AVNSDCYLFQ  420
PSNHKDSDAV ESEKAKCPKR DRGQKEHPIL H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-20239295258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-20239295258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-20239295258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-20239295258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-20239295258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-20239295258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-20239295258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-20239295258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G151400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372269.10.0myb family transcription factor PHL6
TrEMBLU5FJJ40.0U5FJJ4_POPTR; Uncharacterized protein
STRINGPOPTR_0018s14830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1703558
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-51G2-like family protein