PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G142400.1
Common NamePOPTR_0018s13920g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-PHD
Protein Properties Length: 728aa    MW: 82218.6 Da    PI: 10.023
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G142400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.85.9e-11507551953
                         HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
            Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                         ++ +e L ++F++n  ps++ +e L+k+lgL+  +V+ WF+N R+
  Potri.018G142400.1 507 PDAVEKLRQVFAENELPSRTVKENLSKELGLEPGKVSKWFKNSRY 551
                         67899**************************************97 PP

2PHD34.93.5e-12237291150
                         SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHT CS
                 PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCke 50 
                         +C+ C+     +++++vlCd +C+ +fH+kCl+++l++e++p g   w+C+ C++
  Potri.018G142400.1 237 FCAKCKLneVSQDNDIVLCDgTCNCAFHQKCLDPPLDTENIPPGdqGWFCKFCDC 291
                         699998866667********56********************9999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579035.09E-13229294IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.3E-11233291IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.238235292IPR019787Zinc finger, PHD-finger
SMARTSM002498.1E-8237290IPR001965Zinc finger, PHD-type
PfamPF006281.5E-9237291IPR019787Zinc finger, PHD-finger
CDDcd155045.65E-31237289No hitNo description
PROSITE patternPS013590238289IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.603.7E-12494550IPR009057Homeodomain-like
SuperFamilySSF466893.21E-10495556IPR009057Homeodomain-like
PROSITE profilePS5007112.276496556IPR001356Homeobox domain
SMARTSM003894.3E-10498560IPR001356Homeobox domain
CDDcd000861.14E-8499560No hitNo description
PfamPF000461.9E-8507551IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 728 aa     Download sequence    Send to blast
MGDSGKKSKQ QDLHESSPSD TVNGSLLIKS LKIKKGGKLS HRKSEKPKTK PHLKTIINSS  60
VSKKKVTPKK GIRNGSTSRR LIHRKILHKA LDKKASRNGA SSELQGKQLS TIDSEGNGKN  120
ADEGAIKKVK KRKPKKRQKD KVKLDEPPRL QRRARYLMIK MKLEQNLIDA YSGEGWKGKS  180
REKIRPEKEL LRARKQILKC KLGLREIIRQ VDSLSTVGCI EDAVMAPDGS VSHEHIFCAK  240
CKLNEVSQDN DIVLCDGTCN CAFHQKCLDP PLDTENIPPG DQGWFCKFCD CRMEIIEAMN  300
AHLGTHFSED SGWQDIFKEE AAVPDGGNML LNPEEEWPSD DSEDDDYDPE RRENVMSGAG  360
TDDDASDDTS NSTRLSWSSD GEVFSGSRRW EVDGLDFRNN SIYSSLDSDE TSDGEIICGR  420
RQRRAVDYKK LYNEMFGKDA PAHEQPSEDE DWGPSKRKRR EKESDAASTL MTLYESKRRC  480
KNDATIEGMM KLPRDPQIRR PIFRLPPDAV EKLRQVFAEN ELPSRTVKEN LSKELGLEPG  540
KVSKWFKNSR YLALKSRKVE KGEQVHYSSS KVSAEPTLNV MKDKTADLSL LKDSQAETGV  600
CTPENLKRIL QRKKPRSISK SLKKNEQKRG SFESPTKSNE MNVEHNDDLS LKKLLKAKTK  660
GVKKKGNRIS AAAESDMEKL CRAKTRVENL KQKLVKLQTG KARKSSKIRP LDESVVYVPI  720
AELREKK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126132KKVKKRK
2456461RKRREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325264.10.0hypothetical protein POPTR_0018s13920g
SwissprotP487851e-159PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLB9IN730.0B9IN73_POPTR; Uncharacterized protein
STRINGPOPTR_0018s13920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18301539
FabidsOGEF52753349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-153pathogenesis related homeodomain protein A