PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G133100.1
Common NamePOPTR_0018s13300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 208aa    MW: 23925.1 Da    PI: 8.6411
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G133100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.3e-1987141256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tkeq   Lee F+++ +++ +++  LA++l+L+ rqV vWFqNrRa+ k
  Potri.018G133100.1  87 RKKLRLTKEQSSLLEESFRRHTTLNPAQKHSLAEQLNLKPRQVEVWFQNRRARTK 141
                         678899***********************************************98 PP

2HD-ZIP_I/II123.31.2e-3987176190
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                         +kk+rl+keq++lLEesF+++++L+p +K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke ++Lr++
  Potri.018G133100.1  87 RKKLRLTKEQSSLLEESFRRHTTLNPAQKHSLAEQLNLKPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCESLSNENRRLKKELQQLRSQ 176
                         69*************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.13583143IPR001356Homeobox domain
SuperFamilySSF466899.41E-1984151IPR009057Homeodomain-like
SMARTSM003898.4E-1685147IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-1787141IPR009057Homeodomain-like
PfamPF000463.3E-1687141IPR001356Homeobox domain
CDDcd000861.69E-1587144No hitNo description
PROSITE patternPS000270118141IPR017970Homeobox, conserved site
PfamPF021837.7E-10143176IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.6E-18143188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MEAEGYCDTR LGLGLGGDNH EPWPQKKKEK PVVRLDLSFT LCPKNDAMDM DHHDKADGIC  60
FKSEEDEEYG IKRRDNSIDS NIDGSGRKKL RLTKEQSSLL EESFRRHTTL NPAQKHSLAE  120
QLNLKPRQVE VWFQNRRART KLKQTEVDCE FLKKCCESLS NENRRLKKEL QQLRSQKMGR  180
SSPLYTQLAK EGTSTMCCSS CKGKYHD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135143RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G133100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024446568.11e-153homeobox-leucine zipper protein HAT14 isoform X2
SwissprotP466652e-48HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2K1X0A81e-152A0A2K1X0A8_POPTR; Uncharacterized protein
STRINGPOPTR_0018s13300.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56642851
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-50homeobox from Arabidopsis thaliana