PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G129800.6
Common NamePOPTR_0018s12990g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family YABBY
Protein Properties Length: 169aa    MW: 19114.5 Da    PI: 9.703
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G129800.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY173.61.2e-53614123170
               YABBY  23 avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvp 113
                         +vsvP + lf +vtvrCGhCt+l svn+a a q l+ ++h++    +++ ++ + +  +     + +++ st ++++       + v++  
  Potri.018G129800.6   6 IVSVPCSNLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDHVQ--ASNHISHDYRIDMGS---SSKFNNKISTRTPAT-------NIVTQER 84 
                         69*************************************944..445565555544322...222223333333332.......2333334 PP

               YABBY 114 pvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                          v+rPPekrqrvPsayn+fikeeiqrika+nP+ishreafs+aaknWahfP+i fgl
  Potri.018G129800.6  85 VVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPEISHREAFSTAAKNWAHFPHIQFGL 141
                         579****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.8E-586141IPR006780YABBY protein
SuperFamilySSF470957.46E-885135IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.4E-489135IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MQKNPIVSVP CSNLFDIVTV RCGHCTNLWS VNMAAAFQSL SWQDHVQASN HISHDYRIDM  60
GSSSKFNNKI STRTPATNIV TQERVVNRPP EKRQRVPSAY NQFIKEEIQR IKANNPEISH  120
REAFSTAAKN WAHFPHIQFG LMLETNNQAK LDDGSDKHLM SRSALLNN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.73860.0bud
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G129800.6
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6677431e-62KJ667743.1 Solanum melongena YAB5 protein mRNA, complete cds.
GenBankKJ6677451e-62KJ667745.1 Solanum aethiopicum YAB5 protein mRNA, complete cds.
GenBankKJ6677471e-62KJ667747.1 Solanum torvum YAB5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324648.21e-119axial regulator YABBY 5
SwissprotQ8GW468e-72YAB5_ARATH; Axial regulator YABBY 5
TrEMBLB9IMX91e-117B9IMX9_POPTR; Uncharacterized protein
STRINGPOPTR_0018s12990.11e-118(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.24e-74YABBY family protein
Publications ? help Back to Top
  1. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]