PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G114100.1
Common NamePOPTR_0018s12200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 335aa    MW: 38045.5 Da    PI: 6.0821
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G114100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-072853172254
                         SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          +yps+e++++L +++gL+ +q+ +WF N+R +
  Potri.018G114100.1 285 WPYPSEEDKARLVQETGLQLKQINNWFINQRKR 317
                         69*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.0E-1673117IPR005540KNOX1
PfamPF037901.5E-1675115IPR005540KNOX1
SMARTSM012564.2E-25126181IPR005541KNOX2
PfamPF037912.8E-18130180IPR005541KNOX2
PROSITE profilePS512139.167238258IPR005539ELK domain
PROSITE profilePS5007111.596258321IPR001356Homeobox domain
SMARTSM003891.4E-10260325IPR001356Homeobox domain
SuperFamilySSF466895.56E-16260322IPR009057Homeodomain-like
CDDcd000863.37E-11261320No hitNo description
Gene3DG3DSA:1.10.10.601.2E-24265321IPR009057Homeodomain-like
PfamPF059208.0E-18278317IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAFEDHHHIP QEMAFQLQHH HLSASSSTGP PWLSNAVLRR NGDFITIEKT ENTTNNGSEE  60
ELVDSVSDNW ERAKCKAEIL GHPFYEQLLA AHVACLRIAT PVDQLARIDT QLARSQDVIA  120
KYSGVGCGHV VDEKELDQFM THYALLLCSF KDQLQQHVRV HAMEAVMACW ELEQSLQSLT  180
GVSPGEGTGA TMSDDEDDQA ESDTNFNDGN LDGLDTMGFG PLVPTETERS LMERVRQELK  240
HEFKQDYKEK IVDIREEILR KRRAGKLPGD TTSHLKAWWQ THSKWPYPSE EDKARLVQET  300
GLQLKQINNW FINQRKRNWH SSPSGSTSKS KRKK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1314333RKRNWHSSPSGSTSKSKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.15890.0bud| catkin
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G114100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7699990.0KP769999.1 Populus tomentosa Homeobox protein knotted-1-like 3 (Potri.006G190000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324571.20.0homeobox protein knotted-1-like LET12
SwissprotP480001e-160KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLB9IMJ90.0B9IMJ9_POPTR; Uncharacterized protein
STRINGPOPTR_0018s12200.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-156KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]