PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G111300.1
Common NamePOPTR_0018s11960g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 708aa    MW: 77521.5 Da    PI: 5.6358
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G111300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.92.3e-28207260155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv+av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQk+Rl
  Potri.018G111300.1 207 KPRVVWSVELHQKFVSAVNQL-GLDKAVPKKILDLMNVDGLTRENVASHLQKFRL 260
                         79*******************.********************************8 PP

2Response_reg86.57.5e-29231311109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ +++l+++l+k +y ev+++ ++  ale+l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i++++hg++e + + 
  Potri.018G111300.1  23 VLAVDDDPICLKVLENLLRKCQY-EVTTTNQAVTALEMLRENRnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSSHGDKEFVFKG 111
                         799********************.***************999889*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+  eel +
  Potri.018G111300.1 112 ITHGAVDYLLKPVRLEELKN 131
                         *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.7E-1631707IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23008.9E-4320155No hitNo description
SuperFamilySSF521722.99E-3720145IPR011006CheY-like superfamily
SMARTSM004484.0E-3621133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.82722137IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.8E-2623131IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.84E-3124137No hitNo description
Gene3DG3DSA:1.10.10.608.5E-30204265IPR009057Homeodomain-like
PROSITE profilePS5129412.608204263IPR017930Myb domain
SuperFamilySSF466892.51E-19205264IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-24207260IPR006447Myb domain, plants
PfamPF002492.0E-7209258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    Send to blast
MTVEDQRGCN SVNEKMFPVG MRVLAVDDDP ICLKVLENLL RKCQYEVTTT NQAVTALEML  60
RENRNKYDLV ISDVNMPDMD GFKLLELVGL EMDLPVIMLS SHGDKEFVFK GITHGAVDYL  120
LKPVRLEELK NIWQHVIRRK KWYPQDQNGS PDQDKGGDGA GEGEQVTSTG SADQNGKVNR  180
KRKDQDEEEE GEGEDGNDNE ESGNQKKPRV VWSVELHQKF VSAVNQLGLD KAVPKKILDL  240
MNVDGLTREN VASHLQKFRL YLKRLSCGAN QQPNMVAAFG AKDSSYLRMG SLDGFGDFRS  300
VHGPGQLSTT SLSSYPPGSL LGRLNSPGGL TLQGIASPGL LQPGHSRSLN NPLNTLGKLQ  360
PGLLQTNRGS TNLFQGISSA LDPKQFQLKS MNHTGDFNHK GDATSFTLAG CFPDVKVTIG  420
SLGNTISSAA NNPQMLHVNP QQNQTRRSLA TQSSLSMPSL NQESFDVGVR GSSNFLDHSR  480
CDDNWQGVVQ MSTFPSNSLP LGEPFRHDPL PTSTRRDNIS STTSHIVNNP LDFSSSGSLT  540
APLEDSRLDM QGQADLVGNI FHNTNYTSKN RWGENSQNFN PCLNGSFGAM NSLVSGNGSM  600
NPLSQSMDQR KRFDASVLGQ SNSGTLSMFQ HLEAGNSALD PTGMRIPKMR SNEDFLLEQT  660
KSPNGFVQNN YDSLDDIVNA MIKRDQNDGV LMDGEFGFES YSPGSCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-26205266364ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.177260.0bud| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G111300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081420.0FN908142.1 Populus x canadensis mRNA for putative B-type response regulator 19 (rr19 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325148.20.0two-component response regulator ARR12 isoform X1
TrEMBLB9IMH10.0B9IMH1_POPTR; Uncharacterized protein
STRINGPOPTR_0018s11960.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-112response regulator 12