PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G065400.1
Common NamePOPTR_0018s07140g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 383aa    MW: 43351.2 Da    PI: 8.5832
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G065400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.65.9e-2576119144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  Potri.018G065400.1  76 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 119
                         79***************************************997 PP

2QLQ59.78.1e-211044236
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                        +FTa+Q+q+L++Q+l+yKy++++ P+Pp+Ll+ i+
  Potri.018G065400.1 10 PFTASQWQELEHQALIYKYMVSGIPIPPDLLFTIK 44
                        8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.1E-12945IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.7411045IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-151043IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.9876120IPR014977WRC domain
PfamPF088791.4E-2077119IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MIMSGGNRFP FTASQWQELE HQALIYKYMV SGIPIPPDLL FTIKRSVCLD SSKLFPHQHP  60
HFAWSCFQMG LGRKTDPEPG RCRRTDGKKW RCSKEAYPDS KYCERHMHRG KNRSRKPVEV  120
ATQTQSTSPP TVSSITRNHS NNSLLTTSSH SHLSLLMSPE TQHQNHLHYP AGYHAHPNHQ  180
FLSSSTPTGI GLLPQENSTH LLLDSGGSSM TNTDFRRSVY GLKEEVDEHA FFSEPSGSMR  240
RLSGSSLDDA WQLTPLTMNS SSSSTNSSKQ RSLSSLHNEY SYLQLQSLCD HDIPKQQKQH  300
QHNYLLGNDI SNLGPIKMEK EEPQKTVHRF FDEWPPKNKE SWFDLDNRSS NSASVSTTRL  360
SISIPSSHDF LPIFNSRTNN DA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.144211e-151bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G065400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1826620.0AC182662.2 Populus trichocarpa clone Pop1-15O24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024445834.10.0growth-regulating factor 1 isoform X1
TrEMBLA0A2K1WWV80.0A0A2K1WWV8_POPTR; Uncharacterized protein
STRINGPOPTR_0018s07140.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.18e-55growth-regulating factor 5