PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G063000.3
Common NamePOPTR_0018s07420g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 1052aa    MW: 117745 Da    PI: 6.2898
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G063000.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.91.4e-21130230198
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g + +p++ ae++      +++++  ++l+ +d++ ++W++++iyr++++r++lt+GW+ Fv+ +++ +gD+v+F + 
  Potri.018G063000.3 130 FCKTLTASDTSTHGGFFVPRRAAEKIfppldfSMQPPA-QELVARDLHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRIFTGDSVLFIR- 218
                         99*****************************9445444.38************************************************4. PP

                         SSSEE..EEEEE- CS
                  B3  86 grsefelvvkvfr 98 
                          +++ +l+++++ 
  Potri.018G063000.3 219 -DEKSQLLLGIRH 230
                         .466667888875 PP

2Auxin_resp116.42.5e-38256338183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa+++s+F+++YnP+as+seFv++++k++ka++++ s+GmRf+m+f te+s  rr++Gt++g+sdldpvrW+nS+Wr+L+
  Potri.018G063000.3 256 AAHAAANNSPFTIFYNPSASPSEFVIPFSKYNKAMYTQGSLGMRFRMMFTTEESGVRRYMGTITGISDLDPVRWKNSQWRNLQ 338
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.88E-44120259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-40121245IPR015300DNA-binding pseudobarrel domain
CDDcd100173.90E-18129229No hitNo description
PROSITE profilePS5086311.773130232IPR003340B3 DNA binding domain
SMARTSM010199.7E-22130232IPR003340B3 DNA binding domain
PfamPF023621.2E-19130230IPR003340B3 DNA binding domain
PfamPF065072.4E-33256338IPR010525Auxin response factor
PfamPF023094.4E-109301021IPR033389AUX/IAA domain
PROSITE profilePS5174524.6649351028IPR000270PB1 domain
SuperFamilySSF542772.65E-99461013No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1052 aa     Download sequence    Send to blast
MGSCQILQKI CLILVLRTGE RKSINSELWH ACAGPLVSLP PVGSLVVYFP QGHSEQVAAS  60
MQKETDFVPS YPNLTSKLIC MLHNVTLHAD VETDEVYAQM TLQPVSKYDK EALLASDLGQ  120
KQSRQPTEFF CKTLTASDTS THGGFFVPRR AAEKIFPPLD FSMQPPAQEL VARDLHDNTW  180
TFRHIYRGQP KRHLLTTGWS VFVSTKRIFT GDSVLFIRDE KSQLLLGIRH ANRQQPALSS  240
SLISSDSMHI GILAAAAHAA ANNSPFTIFY NPSASPSEFV IPFSKYNKAM YTQGSLGMRF  300
RMMFTTEESG VRRYMGTITG ISDLDPVRWK NSQWRNLQVG WDESTASERP NRVSIWEIEP  360
VVTPFYICPP PFFRPKFPKQ PGMPNDESDT ENAFKRAVPW LGDEFGKKDA ASSIFPGLSL  420
VQWMSMQQNN QFQAAQSGFF PPMVPSNDLQ KNLSTDDPSK LLNFQAPGLS APSIQFNKTN  480
SENQVGQLRR PPMAWTQQQQ LQQLLQTSIN QQQPPYPQQP QPQLQHVVSP NQIPNQNFQK  540
PFVYSQQQQQ QQQQLLASNI QSQSIPSPNR SSYQLTSLPQ DSQFHQQMEQ QSNFSHRQQT  600
QLQQSPLLLL QQNPSQRVQP QPHQQIQQLS QPDNSEQQLH LQLLQNLQQQ QQQQLLSPES  660
LLLQSQKLQQ QQQTHQQNQQ LHQSPLTQNQ QPLGSNSFPT AAALMRTQSF PMNQLQGMQN  720
ATMAVRYHSS ITDGEAPSCS TSPSTNNWQI SPLNFLNRNQ QAPAMLMGDS AIEPASNLVQ  780
ELQSKSEIHI KNEFPSLKGL DQLKYKGTVT DQLEASSSGT SYCLDAGTIQ QNFSAPTFGL  840
DGDVQSHPAS NIDALAPDTL LSREYDSQKD LQNLLVNYGG TAQDINMELS TAAISAQSFG  900
VSNIPFKPDG SNDIAINDTG ILNNGAWTNQ NQRMRTYTKV QKRGSVGRSI DITCYKGYDE  960
LRHDLARMFG IEGQLEDPQS SDWKLVYVDR ENDILLVGDD PWEEFMSCVQ SIKILSSAEV  1020
QQMSLDGDLG NVPAPNQACS GTDSGNVWRG Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1661835944388Auxin response factor 5
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G063000.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006169.10.0PREDICTED: auxin response factor 19-like isoform X1
RefseqXP_011006170.10.0PREDICTED: auxin response factor 19-like isoform X1
TrEMBLG7JS690.0G7JS69_MEDTR; Auxin response factor
STRINGPOPTR_0018s07420.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19