PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G063000.2
Common NamePOPTR_0018s07420g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 1048aa    MW: 117203 Da    PI: 6.1347
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G063000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.91.4e-21126226198
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g + +p++ ae++      +++++  ++l+ +d++ ++W++++iyr++++r++lt+GW+ Fv+ +++ +gD+v+F + 
  Potri.018G063000.2 126 FCKTLTASDTSTHGGFFVPRRAAEKIfppldfSMQPPA-QELVARDLHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRIFTGDSVLFIR- 214
                         99*****************************9445444.38************************************************4. PP

                         SSSEE..EEEEE- CS
                  B3  86 grsefelvvkvfr 98 
                          +++ +l+++++ 
  Potri.018G063000.2 215 -DEKSQLLLGIRH 226
                         .466667888875 PP

2Auxin_resp116.42.5e-38252334183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa+++s+F+++YnP+as+seFv++++k++ka++++ s+GmRf+m+f te+s  rr++Gt++g+sdldpvrW+nS+Wr+L+
  Potri.018G063000.2 252 AAHAAANNSPFTIFYNPSASPSEFVIPFSKYNKAMYTQGSLGMRFRMMFTTEESGVRRYMGTITGISDLDPVRWKNSQWRNLQ 334
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.75E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-40117241IPR015300DNA-binding pseudobarrel domain
CDDcd100173.88E-18125225No hitNo description
SMARTSM010199.7E-22126228IPR003340B3 DNA binding domain
PROSITE profilePS5086311.773126228IPR003340B3 DNA binding domain
PfamPF023621.1E-19126226IPR003340B3 DNA binding domain
PfamPF065072.4E-33252334IPR010525Auxin response factor
PfamPF023094.4E-109261017IPR033389AUX/IAA domain
PROSITE profilePS5174524.6649311024IPR000270PB1 domain
SuperFamilySSF542772.65E-99421009No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1048 aa     Download sequence    Send to blast
MKVPSNGFLP NSAEGERKSI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
TDFVPSYPNL TSKLICMLHN VTLHADVETD EVYAQMTLQP VSKYDKEALL ASDLGQKQSR  120
QPTEFFCKTL TASDTSTHGG FFVPRRAAEK IFPPLDFSMQ PPAQELVARD LHDNTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRIFTGDSV LFIRDEKSQL LLGIRHANRQ QPALSSSLIS  240
SDSMHIGILA AAAHAAANNS PFTIFYNPSA SPSEFVIPFS KYNKAMYTQG SLGMRFRMMF  300
TTEESGVRRY MGTITGISDL DPVRWKNSQW RNLQVGWDES TASERPNRVS IWEIEPVVTP  360
FYICPPPFFR PKFPKQPGMP NDESDTENAF KRAVPWLGDE FGKKDAASSI FPGLSLVQWM  420
SMQQNNQFQA AQSGFFPPMV PSNDLQKNLS TDDPSKLLNF QAPGLSAPSI QFNKTNSENQ  480
VGQLRRPPMA WTQQQQLQQL LQTSINQQQP PYPQQPQPQL QHVVSPNQIP NQNFQKPFVY  540
SQQQQQQQQQ LLASNIQSQS IPSPNRSSYQ LTSLPQDSQF HQQMEQQSNF SHRQQTQLQQ  600
SPLLLLQQNP SQRVQPQPHQ QIQQLSQPDN SEQQLHLQLL QNLQQQQQQQ LLSPESLLLQ  660
SQKLQQQQQT HQQNQQLHQS PLTQNQQPLG SNSFPTAAAL MRTQSFPMNQ LQGMQNATMA  720
VRYHSSITDG EAPSCSTSPS TNNWQISPLN FLNRNQQAPA MLMGDSAIEP ASNLVQELQS  780
KSEIHIKNEF PSLKGLDQLK YKGTVTDQLE ASSSGTSYCL DAGTIQQNFS APTFGLDGDV  840
QSHPASNIDA LAPDTLLSRE YDSQKDLQNL LVNYGGTAQD INMELSTAAI SAQSFGVSNI  900
PFKPDGSNDI AINDTGILNN GAWTNQNQRM RTYTKVQKRG SVGRSIDITC YKGYDELRHD  960
LARMFGIEGQ LEDPQSSDWK LVYVDRENDI LLVGDDPWEE FMSCVQSIKI LSSAEVQQMS  1020
LDGDLGNVPA PNQACSGTDS GNVWRGQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1661535545388Auxin response factor 5
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G063000.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006171.10.0PREDICTED: auxin response factor 19-like isoform X2
TrEMBLG7JS690.0G7JS69_MEDTR; Auxin response factor
STRINGPOPTR_0018s07420.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19