PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G049700.1
Common NamePOPTR_0018s05520g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 611aa    MW: 70003.4 Da    PI: 6.4533
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G049700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.64.7e-30413497186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+k+ev aLi++r+++e ++++   k+plWeevs+ m++ g++rs+k+Ckekwen+nk+++k ke+ ++r s++s+tc+yf+ql+
  Potri.018G049700.1 413 RWPKDEVEALIKVRSRIEIKFQEPGVKGPLWEEVSSLMSSMGYQRSAKRCKEKWENINKYFRKAKESPERR-SQRSKTCSYFNQLD 497
                         8********************************************************************98.88999********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.503406470IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.6E-4411469IPR009057Homeodomain-like
CDDcd122031.08E-24412477No hitNo description
PfamPF138371.9E-20412499No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MQPSNGGLSY IHHHHHQQQE RQQHSMEDDC CCSPSVLQNL NHPCLSHLQQ EQHKQPHQVF  60
LQQHHQLFYP FQQQQQQEQQ SQGQGTPQNP SLFTMSFKLG RNEGSGNRKA SALNNQDEVA  120
ATPTLLDGNE HINPPHAILM PRSWHPLEDY TTIKEPFWKQ LEKKRWGSEE EEISGNRTRY  180
FRPLEIEHVV DESRERCRNL DIKFPIFNEL EAIYSLAKIA EANQTGSGSV LTGDHSPTNA  240
GVSVPSSATN RQNVGANGAA NNVTGVDHGS ENSIGEEASL RKSQKRKRKR KLKEKLSYMA  300
GFFENTVKKV MDHQEMLHRK FLEVIERMDR ERTDREETWR HQEAEKHNRE AISRAHERAS  360
TSNREAQMVS YIERITGQSI NLPIRMAPPL LQPEISNEPI KEITSTKSDS HSRWPKDEVE  420
ALIKVRSRIE IKFQEPGVKG PLWEEVSSLM SSMGYQRSAK RCKEKWENIN KYFRKAKESP  480
ERRSQRSKTC SYFNQLDQLY SSSLINYPSS TTYMPSRGIE FDIEKQGHSE VLEAFAVGKD  540
HLATITNPPG ENIKGAEMSS SRFEFDGIAE KNEELEEGSS EQDKEVYKDD KQENGEQGKD  600
DGSGDEENEN *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1284290KRKRKRK
2284291KRKRKRKL
3285290RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324189.20.0hypothetical protein POPTR_0018s05520g
TrEMBLB9IKD40.0B9IKD4_POPTR; Uncharacterized protein
STRINGPOPTR_0018s05520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139981421
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-43Trihelix family protein