PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G049000.1
Common NamePOPTR_0018s08500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 183aa    MW: 21061.1 Da    PI: 9.5487
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G049000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591e-181764148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l+++++ +G+++W++Ia++  ++R++k+c++rw ++l
  Potri.018G049000.1 17 KGAWTAEEDQKLARVIEIHGPKRWRSIAAKADLNRCGKSCRLRWMNHL 64
                        79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-23967IPR009057Homeodomain-like
PROSITE profilePS5129426.1361268IPR017930Myb domain
SMARTSM007174.9E-161666IPR001005SANT/Myb domain
PfamPF002491.3E-171764IPR001005SANT/Myb domain
SuperFamilySSF466894.04E-241895IPR009057Homeodomain-like
CDDcd001671.46E-111964No hitNo description
PROSITE profilePS500905.8196597IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.3E-116897IPR009057Homeodomain-like
SMARTSM007173.369107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MPLAPRRSKC GKKEANKGAW TAEEDQKLAR VIEIHGPKRW RSIAAKADLN RCGKSCRLRW  60
MNHLRPNIKR GNISDQEEDL ILRLHKLLGN RWSLIADNKK IKQKEEKPVI ISTLKQPEPE  120
KSNVLGMDNI AKGREEGTSK RLEDSKSSFV GDDFFDFSNE DPVNLEWMSK FLELEESLYE  180
FP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-201796482MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G049000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285446e-40FR828544.1 Rosa rugosa mRNA for putative MYB transcription factor (myb11 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011010380.11e-120PREDICTED: transcription factor MYB114-like
SwissprotP102903e-36MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A2K1WW011e-130A0A2K1WW01_POPTR; Uncharacterized protein
STRINGPOPTR_0018s08500.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.13e-37myb domain protein 66
Publications ? help Back to Top
  1. Chen B,Wang X,Hu Y,Wang Y,Lin Z
    Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco.
    Mol. Biotechnol., 2004. 26(3): p. 187-92
    [PMID:15004287]
  2. Paz-Ares J,Ghosal D,Saedler H
    Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus.
    EMBO J., 1990. 9(2): p. 315-21
    [PMID:2303027]
  3. Cone KC,Burr FA,Burr B
    Molecular analysis of the maize anthocyanin regulatory locus C1.
    Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5
    [PMID:3025847]
  4. Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H
    The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators.
    EMBO J., 1987. 6(12): p. 3553-8
    [PMID:3428265]
  5. Scheffler B, et al.
    Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene.
    Mol. Gen. Genet., 1994. 242(1): p. 40-8
    [PMID:7904044]
  6. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]
  7. Singer T,Gierl A,Peterson PA
    Three new dominant C1 suppressor alleles in Zea mays.
    Genet. Res., 1998. 71(2): p. 127-32
    [PMID:9717435]