PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G048000.1
Common NamePOPTR_0018s08400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 83aa    MW: 9487.28 Da    PI: 10.5272
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G048000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.14.9e-181653845
                        HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                         rq  +skR+ gilKKA+EL +LCd++ a+++fs+tgk
  Potri.018G048000.1 16 ARQAKYSKRKIGILKKAKELAILCDIDLALLMFSPTGK 53
                        69999********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-22160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.866161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-21277IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-15323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-171455IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MGRRRLKIQR LECVKARQAK YSKRKIGILK KAKELAILCD IDLALLMFSP TGKPTLYVGQ  60
DKDFGTVLDR MSALTFEERE ER*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G048000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012432.14e-40PREDICTED: agamous-like MADS-box protein AGL65
SwissprotQ7X9I02e-23AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLB9IKF01e-51B9IKF0_POPTR; Uncharacterized protein
STRINGPOPTR_0018s08400.12e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2051955
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26320.12e-19AGAMOUS-like 33
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]