PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G021300.6
Common NamePOPTR_0018s02330g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 667aa    MW: 73185.8 Da    PI: 6.3026
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G021300.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.56.1e-28199252155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+ Lt+e+v+SHLQkYR 
  Potri.018G021300.6 199 KPRVVWSVELHRKFVAAVNQL-GVDKAVPKKILDLMNVEKLTRENVASHLQKYRH 252
                         79*******************.********************************6 PP

2Response_reg75.42.1e-25211291109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ + ll+++l++ +y +v++++++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+++++ + 
  Potri.018G021300.6  21 VLAVDDDPTCLLLLETLLRRCQY-NVTTTSQAITALRMLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDPKLVMKG 109
                         799********************.***************888888*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga  +l Kp+ +eel +
  Potri.018G021300.6 110 ITHGACYYLLKPVRIEELKT 129
                         *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.56E-3518143IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.7E-4118156No hitNo description
SMARTSM004481.4E-3119131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.99120135IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.4E-2321130IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.76E-2322135No hitNo description
SuperFamilySSF466891.7E-19196256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-29196257IPR009057Homeodomain-like
PROSITE profilePS5129413.367196255IPR017930Myb domain
TIGRFAMsTIGR015571.5E-24199252IPR006447Myb domain, plants
PfamPF002493.0E-7201251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MTVEQGIGDS NIDQFPIGMR VLAVDDDPTC LLLLETLLRR CQYNVTTTSQ AITALRMLRE  60
NKNKFDLVIS DVHMPDMDGF KLLELVGLEM DLPVIMLSAN GDPKLVMKGI THGACYYLLK  120
PVRIEELKTI WQHVIRRKKS DNKDRNSSDN RDKPNQGSSE AVPDQKLNKK RKDQNGDEDE  180
DHDEDEDEHE NEDPTTQKKP RVVWSVELHR KFVAAVNQLG VDKAVPKKIL DLMNVEKLTR  240
ENVASHLQKY RHYLKRISTV ANQQANMVAA LGSSDASYLQ MNSMSVLGLH SLAGSVQFHS  300
TPFRSLQSSG MLDRLNSPAV LGIHGLPSPG VIQLGHVQTA PHTANGLSHF QPVGHRGNNG  360
NILQGMPMPL ELDQIQSNKG VNYIPELPTH LDDTASFPVS SGSTDMKIIA GSSNSPFVGV  420
SNKHLMLEGH GQGLQDGQKS GKQSSLSAGS LNPGYSSHFP DHGRCNDNWS NAVPSNGAQS  480
DSFTLNDYFK QSTLHPSAIR DRMSTMALQS RNNPCDVSSV STLPMHLQDS KADLPCRVGV  540
ATVSSNAGQL INNGSLGWDD RRQDDPYHSN GLSNSINSAF PINGNGSPNG FNLDPNNLFF  600
QRTTSFISTG PSNFVDTSLM KHNEVECSAM ETLVRSKDGY LLGQEKPQDS SVSNNFGSLE  660
DLEQDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-26195258164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G021300.6
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081440.0FN908144.1 Populus x canadensis mRNA for putative B-type response regulator 22 (rr22 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024446135.10.0two-component response regulator ORR24 isoform X3
SwissprotA2X1N21e-147ORR24_ORYSI; Two-component response regulator ORR24
SwissprotQ6H8051e-147ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A2K1WUJ90.0A0A2K1WUJ9_POPTR; Two-component response regulator
STRINGPOPTR_0018s02330.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-119response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]