PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.018G005300.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 373aa    MW: 41367.8 Da    PI: 5.9267
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.018G005300.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.4e-174891146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        rg+++++E++l+++++k+lG++ W++Ia +++ gRt++++k++w++
  Potri.018G005300.4 48 RGNFSEDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWHT 91
                        89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.6121242IPR017877Myb-like domain
SuperFamilySSF466892.22E-202899IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-112854IPR009057Homeodomain-like
PROSITE profilePS5129426.2274397IPR017930Myb domain
SMARTSM007176.8E-164795IPR001005SANT/Myb domain
PfamPF002492.6E-154891IPR001005SANT/Myb domain
CDDcd001672.42E-125093No hitNo description
Gene3DG3DSA:1.10.10.602.2E-215593IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MLCMSNRMLL GWKNRAVSDA CIHIVGLKRC GKSCRLRWMN YLRPNIKRGN FSEDEEDLII  60
RLHKLLGNRW SLIAGRLPGR TDNEIKNYWH TTIAKKAQHR QLRGQPKVDR KQIASGSQNG  120
AASNLKNQST IESQCTTGMV AATTTLQENT AQDHQDSIAI PKSTNSDLQL DMPKTYENEP  180
SSKGSQNGAA SNFKNQSTIE SQCTTGVVAA TPTLQENTAQ DHQDSIAMAQ STNSNLQYDI  240
PKTNENESSS KGLASGEDDN SSNIMMYYDY MEDFSKILDS DFTKFSDVHD IISTDHHSNN  300
TIEVNGDHHG VSINGCKSRE TAEFPGKLVE SDHWSSNKCI QADQGFDFMS LLSFLDSTDD  360
EWTADALGTK VL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-20299640107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.018G005300.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006371801.10.0myb-related protein 308
TrEMBLB9NA030.0B9NA03_POPTR; Uncharacterized protein
STRINGPOPTR_0018s03770.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.14e-41myb domain protein 66