PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G146800.2
Common NamePOPTR_0017s01140g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 314aa    MW: 33948.3 Da    PI: 9.0877
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G146800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.52.7e-1258102147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Potri.017G146800.2  58 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 102
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.46E-1652108IPR009057Homeodomain-like
PROSITE profilePS5129413.75853107IPR017930Myb domain
TIGRFAMsTIGR015572.3E-1856105IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.2E-656108IPR009057Homeodomain-like
SMARTSM007179.6E-1057105IPR001005SANT/Myb domain
PfamPF002496.0E-1058102IPR001005SANT/Myb domain
CDDcd001671.27E-760103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MVSKNPNPAD GFYLDPNGMA ALPGLSTFPT TTTTTASDSS SEDPSKKIRK PYTITKSRES  60
WTEPEHDKFL EALQLFDRDW KKIEAFIGSK TVIQIRSHAQ KYFLKVQKSG TSEHLPPPRP  120
KRKAAHPYPQ KASKNAVVLS QPSGSSHSSS APLESGCALR PDSSSIPMNP IVSAAAASSW  180
TNNVPTVSVS NQTTGALVAN NCCSSSESTP RTKPVGKTAE KGNHGQSMRV LPDFAQVYGF  240
IGSVFDPNVT GHLHNLKKMD PIDVETVLLL MRNLAINLTS PSFEEHRKLL SSNEMDSEAM  300
GVNKNVDQPM DVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.11730.0leaf| stem
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G146800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2092701e-122AC209270.1 Populus trichocarpa clone POP015-B22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372389.20.0protein REVEILLE 6
SwissprotQ8H0W31e-123RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2K1X8160.0A0A2K1X816_POPTR; Uncharacterized protein
STRINGPOPTR_0017s01140.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-103MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]