PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G144800.1
Common NamePOPTR_0017s01380g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 482aa    MW: 53419.5 Da    PI: 6.5729
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G144800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.7e-1760104147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r rWT+eE+++++da k++G   W++I +++g ++t+ q++s+ qk+
  Potri.017G144800.1  60 RERWTEEEHKKFLDALKLYGRA-WRRIEEHLG-TKTAVQIRSHAQKF 104
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.74E-1654109IPR009057Homeodomain-like
PROSITE profilePS5129421.11355109IPR017930Myb domain
TIGRFAMsTIGR015572.1E-1658107IPR006447Myb domain, plants
SMARTSM007172.9E-1359107IPR001005SANT/Myb domain
PfamPF002499.4E-1460103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-960100IPR009057Homeodomain-like
CDDcd001671.72E-1062105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MAIQDQCGGT RSNLVLPAGN GILPSATLQK ATDHQLKEQF SCGSDYSPKA RKPYTITKQR  60
ERWTEEEHKK FLDALKLYGR AWRRIEEHLG TKTAVQIRSH AQKFFSKVAR ESGGSNTSSE  120
EPIEIPPPRP KRKPMHPYPR KLAHPLERDL LILENPLRSS SPNFSISEQE NQSPTSVLSA  180
VGSDALGSTD SDMPSHSLSP VSSAGGVRHV DSSPEDNGSP SPPTASSAPD EQFPKVQKLD  240
SFPKENVSSE EPITLKLFGR TLLVTECHKP SYPNMGTSKL SLPDATEEKL VQPLTLNITA  300
AKLQSRNEES TWSPLPHGSH GALYQIQFKK ENSSPTENDS AALMPWWGSY EGMPFPFIPF  360
HKHEPAVENL DSNGDEVQDK EIHKEVSWTG SNSGSVNEGE NVDKIMDAET ESHQFSYEEK  420
EPSPFLELKP KKKSASSGSK AFNEKCTKGF VPYKKRTAER DSQSSTITGE EREEQRIRLC  480
L*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.174230.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G144800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1479720.0EF147972.1 Populus trichocarpa clone WS0126_F21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024444596.10.0protein REVEILLE 1
TrEMBLA0A2K1X7Z10.0A0A2K1X7Z1_POPTR; Uncharacterized protein
STRINGPOPTR_0017s01380.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.18e-61MYB_related family protein