PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G144600.1
Common NamePOPTR_0017s01400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 685aa    MW: 75924.4 Da    PI: 6.8079
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G144600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.6e-192681156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++  +++t +q+ +Le++F+++++p++++r++L+++lgL+ +q+k+WFqNrR++ek
  Potri.017G144600.1 26 KKAYHRHTCQQILQLEKFFKECPHPNEKQRRQLSRELGLEAKQIKFWFQNRRTQEK 81
                        6778899***********************************************99 PP

2START124.61.3e-391954153206
                         HHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
               START   3 aeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                         a  a++el+++  ++ep+W ks+       + + ++  + +            ++e +++s+ v+m+ ++lv  +ld + +W   ++    
  Potri.017G144600.1 195 AAGAMDELIRLLRVNEPFWIKSPsdgrlilDRLSYERIYPRA---AHfiscnARVESSKDSATVTMPGMDLVVMFLDPN-KWVDLFPtivt 281
                         6679*******************8777444444444433333...22678999**************************.99999988888 PP

                         EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
               START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                         +a t+ v++ g      g lq m+ ++  lsplvp R+f+f+R + ql+ g+wvi+dvS d  ++   s++  +a +lpSg++i++++ng 
  Potri.017G144600.1 282 EARTIHVLEAGtvgnrhGSLQMMYEQMHILSPLVPpREFYFLRLCLQLEPGQWVIADVSYDYLKESG-SPP--CAWRLPSGCMIQDMPNGC 369
                         *************************************************************999965.555..566*************** PP

                         EEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 162 skvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         sk++wvehv+ ++r+  h l+r l+  ++a ga +w a lqr ce+
  Potri.017G144600.1 370 SKIIWVEHVEANDRIQtHCLYRDLICGSYAYGAERWIASLQRICER 415
                         ***************99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-201385IPR009057Homeodomain-like
SuperFamilySSF466899.19E-191583IPR009057Homeodomain-like
PROSITE profilePS5007117.2652383IPR001356Homeobox domain
SMARTSM003895.7E-162587IPR001356Homeobox domain
CDDcd000861.01E-162684No hitNo description
PfamPF000467.7E-172681IPR001356Homeobox domain
PROSITE patternPS0002705881IPR017970Homeobox, conserved site
PROSITE profilePS5084836.904184418IPR002913START domain
SuperFamilySSF559617.83E-27185416No hitNo description
CDDcd088752.06E-99189414No hitNo description
SMARTSM002342.2E-27193415IPR002913START domain
PfamPF018521.1E-32196415IPR002913START domain
Gene3DG3DSA:3.30.530.202.1E-6288380IPR023393START-like domain
SuperFamilySSF559618.79E-13434647No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MELQLGNNGG VSGDEHEAFN SGNKGKKAYH RHTCQQILQL EKFFKECPHP NEKQRRQLSR  60
ELGLEAKQIK FWFQNRRTQE KAQSERSDNS VLRTENERIH CENLSIREAM KNVICPACGG  120
HPFREEERQL NLQKLRQENA RLREEAKELP TFVQNQRMGN PGIDWGRNPG SDISHFACRL  180
EGIPDMENAL MAETAAGAMD ELIRLLRVNE PFWIKSPSDG RLILDRLSYE RIYPRAAHFI  240
SCNARVESSK DSATVTMPGM DLVVMFLDPN KWVDLFPTIV TEARTIHVLE AGTVGNRHGS  300
LQMMYEQMHI LSPLVPPREF YFLRLCLQLE PGQWVIADVS YDYLKESGSP PCAWRLPSGC  360
MIQDMPNGCS KIIWVEHVEA NDRIQTHCLY RDLICGSYAY GAERWIASLQ RICERLAFST  420
AVPPRELGGV VTSPEGRKSI VNLAHRMVKI FCSSLGMSGK LDFRQLSEGN NSGVRVAICK  480
NAEQGQPIGT VASAATSFWL PLSPQNVFNF FKAEKSRTQW DILSNGNPVL EISHISNGAD  540
PGNCISIIRV ISHPFSPILN NMLILQESCT DSSVSMVVYA PVGIPAMNVA ISGDDSSIIP  600
ILPSGFVISG DGRMDTRGTS SSSTSSTGSN SGGSLLTIAF QILVSGSNSS SSTEFNMESV  660
ATVNTLISTT VLKIKSAFNC SDLD*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During embryo development, expressed in all cells at the 4- and 16-cell embryo stages. Expression is restricted to the protoderm from the globular stage onward. {ECO:0000269|PubMed:25564655}.
UniprotTISSUE SPECIFICITY: Expressed in apical meristems and young epidermal tissue including trichomes and stipules. Expressed in lateral root tips, the L1 layer of apical inflorescence meristems and early flower primordia, carpel and petal epidermis, stigma papillae, ovule primordia, nucellus and embryo. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which acts as positive regulator of drought stress tolerance. Can transactivate CIPK3, NCED3 and ERECTA (PubMed:18451323). Transactivates several cell-wall-loosening protein genes by directly binding to HD motifs in their promoters. These target genes play important roles in coordinating cell-wall extensibility with root development and growth (PubMed:24821957). Transactivates CYP74A/AOS, AOC3, OPR3 and 4CLL5/OPCL1 genes by directly binding to HD motifs in their promoters. These target genes are involved in jasmonate (JA) biosynthesis, and JA signaling affects root architecture by activating auxin signaling, which promotes lateral root formation (PubMed:25752924). Acts as negative regulator of trichome branching (PubMed:16778018, PubMed:24824485). Required for the establishment of giant cell identity on the abaxial side of sepals (PubMed:23095885). May regulate cell differentiation and proliferation during root and shoot meristem development (PubMed:25564655). {ECO:0000269|PubMed:16778018, ECO:0000269|PubMed:18451323, ECO:0000269|PubMed:23095885, ECO:0000269|PubMed:24821957, ECO:0000269|PubMed:24824485, ECO:0000269|PubMed:25564655, ECO:0000269|PubMed:25752924}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G144600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2755411e-144GU275541.1 Populus balsamifera isolate POR11 haplotype B unknown gene, partial sequence.
GenBankGU2755421e-144GU275542.1 Populus balsamifera isolate GIL14 haplotype A unknown gene, partial sequence.
GenBankGU2755431e-144GU275543.1 Populus balsamifera isolate GIL14 haplotype B unknown gene, partial sequence.
GenBankGU2755441e-144GU275544.1 Populus balsamifera isolate KUU07 haplotype A unknown gene, partial sequence.
GenBankGU2755451e-144GU275545.1 Populus balsamifera isolate KUU07 haplotype B unknown gene, partial sequence.
GenBankGU2755461e-144GU275546.1 Populus balsamifera isolate MGR10 haplotype A unknown gene, partial sequence.
GenBankGU2755471e-144GU275547.1 Populus balsamifera isolate MGR10 haplotype B unknown gene, partial sequence.
GenBankGU2755481e-144GU275548.1 Populus balsamifera isolate STO11 haplotype A unknown gene, partial sequence.
GenBankGU2755491e-144GU275549.1 Populus balsamifera isolate STO11 haplotype B unknown gene, partial sequence.
GenBankGU2755501e-144GU275550.1 Populus balsamifera isolate WHR03 haplotype A unknown gene, partial sequence.
GenBankGU2755521e-144GU275552.1 Populus balsamifera isolate FRE01 haplotype A unknown gene, partial sequence.
GenBankGU2755541e-144GU275554.1 Populus balsamifera isolate GAL12 haplotype A unknown gene, partial sequence.
GenBankGU2755561e-144GU275556.1 Populus balsamifera isolate HAY07 haplotype A unknown gene, partial sequence.
GenBankGU2755571e-144GU275557.1 Populus balsamifera isolate HAY07 haplotype B unknown gene, partial sequence.
GenBankGU2755581e-144GU275558.1 Populus balsamifera isolate LOV02 haplotype A unknown gene, partial sequence.
GenBankGU2755591e-144GU275559.1 Populus balsamifera isolate LOV02 haplotype B unknown gene, partial sequence.
GenBankGU2755601e-144GU275560.1 Populus balsamifera isolate RNA13 haplotype A unknown gene, partial sequence.
GenBankGU2755611e-144GU275561.1 Populus balsamifera isolate RNA13 haplotype B unknown gene, partial sequence.
GenBankGU2755621e-144GU275562.1 Populus balsamifera isolate STL13 haplotype A unknown gene, partial sequence.
GenBankGU2755631e-144GU275563.1 Populus balsamifera isolate STL13 haplotype B unknown gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011038413.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A2K2AR950.0A0A2K2AR95_POPTR; Uncharacterized protein
STRINGPOPTR_0017s01400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Khosla A, et al.
    HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23.
    Plant Cell, 2014. 26(5): p. 2184-2200
    [PMID:24824485]
  3. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]
  4. Cai XT,Xu P,Wang Y,Xiang CB
    Activated expression of AtEDT1/HDG11 promotes lateral root formation in Arabidopsis mutant edt1 by upregulating jasmonate biosynthesis.
    J Integr Plant Biol, 2015. 57(12): p. 1017-30
    [PMID:25752924]
  5. Yu LH, et al.
    Arabidopsis EDT1/HDG11 improves drought and salt tolerance in cotton and poplar and increases cotton yield in the field.
    Plant Biotechnol. J., 2016. 14(1): p. 72-84
    [PMID:25879154]
  6. Zhu Z, et al.
    Overexpression of AtEDT1/HDG11 in Chinese Kale (Brassica oleracea var. alboglabra) Enhances Drought and Osmotic Stress Tolerance.
    Front Plant Sci, 2016. 7: p. 1285
    [PMID:27625663]
  7. Liu Y, et al.
    Overexpression of AtEDT1 promotes root elongation and affects medicinal secondary metabolite biosynthesis in roots of transgenic Salvia miltiorrhiza.
    Protoplasma, 2017. 254(4): p. 1617-1625
    [PMID:27915455]
  8. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  9. Lung SC, et al.
    Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
    New Phytol., 2018. 218(1): p. 183-200
    [PMID:29288621]
  10. Zheng G, et al.
    Over-Expression of Arabidopsis EDT1 Gene Confers Drought Tolerance in Alfalfa (Medicago sativa L.).
    Front Plant Sci, 2017. 8: p. 2125
    [PMID:29326737]