PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G137600.2
Common NamePOPTR_0017s02220g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 450aa    MW: 49464 Da    PI: 9.1017
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G137600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32291344255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Potri.017G137600.2 291 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 344
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15288344IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28289344IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23291344IPR006447Myb domain, plants
PfamPF002498.3E-7292343IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MPLEGVFIEP SSNPVPDLSL HISPPNISSP SSICNNNSNI RDKIDASFNL LGRQEAIRKS  60
NTAISMRSDS QACIELSLAH PTTGLNEESI RSRRNLSSAR VEELPHNNPY RQQSHHHQHL  120
HRSNGNTHHL NHINHGVSLL EVSDGLRPIK GIPVYHNRSF PFMPLEHSSR ENKDPKMCFY  180
QMPYPSSSLC SPSVNPHSSS STSSPYSIGG GGLDPMSMLN SSGPNQALPG PYNRLAPTTR  240
FNGLSMDAFK SHQLHHHHNQ YGVGSTDGSP HGLIRSRFLP KLPTKRSMRA PRMRWTSTLH  300
ARFVHAVELL GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTVKTTDK PAASSDGSGE  360
EDMAPIASFR TANEQGGLQR VVQADGPTAQ QDMDYPSTTT SAATTLWSNS SSGREAWPQT  420
NSNDIDGHRQ GTFQSQQRSG QQMEVPSKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-16292346458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-16292346458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-16292346357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16292346357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16292346357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16292346357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-16292346458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-16292346458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-16292346458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-16292346458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-16292346458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-16292346458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G137600.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142140.0AC214214.1 Populus trichocarpa clone POP028-A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024444406.10.0transcription repressor KAN1-like
TrEMBLA0A2K1X7N10.0A0A2K1X7N1_POPTR; Uncharacterized protein
STRINGPOPTR_0017s02220.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-70G2-like family protein