PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G125200.1
Common NamePOPTR_0005s14540g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 620aa    MW: 67306.8 Da    PI: 4.7271
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G125200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.42.1e-1402365991374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         lv++Ll+cAea+++++l+la+al++++  la++++ +m+++a+yf+eALa+r+++    ++ + ++ ++s    s++l +   f+e++P+l
  Potri.017G125200.1 236 LVHTLLACAEAIQQENLKLADALVKHIGVLAASQAGAMRKVATYFAEALARRIYK----IFPQDHCLDSS---YSDTLEM--HFYETCPYL 317
                         689***************************************************9....44333344443...5555555..5******** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         kf+h+taNqaIlea+++++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+++g++La++A+++gv+fef+ +v
  Potri.017G125200.1 318 KFAHFTANQAILEAFANASRVHVIDFGLKQGMQWPALMQALALRPGGPPAFRLTGIGPPQPDNTDALQQVGWKLAQLAQTIGVEFEFRGFV 408
                         ******************************************************************************************* PP

                GRAS 183 akrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         a++l+dle e+L+++p   Ea+aVn+v++lhrlld+++ +++    vL  +k ++Pk+v++veqea+hn++ Fl+rf+eal+yys+lfdsl
  Potri.017G125200.1 409 ASSLADLEAEMLDLRPpeVEAVAVNSVFELHRLLDRPGGIDK----VLGSIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSL 495
                         ****************9999**************99999998....********************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                         e +  + ++++ ++++ +lgr+i+nvvacega+r+erhetl++Wr r+++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lg
  Potri.017G125200.1 496 EGSGVTPTSQDLVMSELYLGRQICNVVACEGADRVERHETLAQWRTRFDSAGFDPVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLG 586
                         8887788899999****************************************************************************** PP

                GRAS 362 WkdrpLvsvSaWr 374
                         W++rpL+++SaW+
  Potri.017G125200.1 587 WHTRPLIATSAWQ 599
                         ************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.4E-3546111IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.5E-3746117No hitNo description
PROSITE profilePS5098569.438210578IPR005202Transcription factor GRAS
PfamPF035147.2E-138236599IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MKRDHQETIG GAGNSIGNKA ESSSSSMATG KGKLWVEDDQ DAGGMDELLA VLGYKIKSSE  60
MADVAQKLEQ LEMVLGSEDG ISHLASDTVH YNPSDLSGWV QSMLSELNNL PSSDLDSSTL  120
LSNNQDSNPS TMTSLDFPNN SQSKAFVDDS EYDLRAIPGV AAYPQQEFDK SNDRKRMKLT  180
LVGSNTAPTL AVNSLQSSNS SCTPSSPQAI MAVSGTLSEP TRPVVLIDSQ ETGVRLVHTL  240
LACAEAIQQE NLKLADALVK HIGVLAASQA GAMRKVATYF AEALARRIYK IFPQDHCLDS  300
SYSDTLEMHF YETCPYLKFA HFTANQAILE AFANASRVHV IDFGLKQGMQ WPALMQALAL  360
RPGGPPAFRL TGIGPPQPDN TDALQQVGWK LAQLAQTIGV EFEFRGFVAS SLADLEAEML  420
DLRPPEVEAV AVNSVFELHR LLDRPGGIDK VLGSIKAMRP KIVTIVEQEA NHNGPVFLDR  480
FTEALHYYSS LFDSLEGSGV TPTSQDLVMS ELYLGRQICN VVACEGADRV ERHETLAQWR  540
TRFDSAGFDP VHLGSNAFKQ ASMLLALFAG GDGYRVEENN GCLMLGWHTR PLIATSAWQL  600
AAGDSRLRVN SAEFELPSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-582365994375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.158190.0leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383329.10.0hypothetical protein POPTR_0005s14540g
SwissprotQ84TQ70.0GAI_GOSHI; DELLA protein GAI
TrEMBLU5GFQ30.0U5GFQ3_POPTR; Uncharacterized protein
STRINGPOPTR_0005s14540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein