PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G112000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family TCP
Protein Properties Length: 375aa    MW: 42204.7 Da    PI: 9.7393
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G112000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP151.26.7e-47962282133
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt.....ssssaseceaesssssasnsss 87 
                          +kkdrhski+T++g+RdRRvRls+e+a++fFdLq++LGfdk+skt++WLl+++k ai el+++      ss++++c    +++s+s + +
  Potri.017G112000.1  96 SVKKDRHSKIYTAQGLRDRRVRLSIEIARKFFDLQEMLGFDKASKTLDWLLTKSKYAIEELAKNggekcLSSTSTNC----EVVSESGDLE 182
                         589*************************************************************7666522222345....5555555555 PP

                 TCP  88 gkaaksaakskksqksaasalnlakesrakarararertrekmrik 133
                         ++  ++++k+k ++ ++ ++  l kesrakar+rarertr km+++
  Potri.017G112000.1 183 DRVPSESQKQKMKKMQNMAVDLLVKESRAKARERARERTRVKMCTR 228
                         6666777788888888888899**********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.5E-4197227IPR005333Transcription factor, TCP
PROSITE profilePS5136935.44998156IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.241207224IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048831Biological Processregulation of shoot system development
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MFSSTSSTIH LFQSLSSSPF NPPPYITDHE TTDIFHQHHH HIDPLTIPSV STNPLPVTET  60
VMNMAASNNS MMSERDVTAL DGELYNRSHF LAGKKSVKKD RHSKIYTAQG LRDRRVRLSI  120
EIARKFFDLQ EMLGFDKASK TLDWLLTKSK YAIEELAKNG GEKCLSSTST NCEVVSESGD  180
LEDRVPSESQ KQKMKKMQNM AVDLLVKESR AKARERARER TRVKMCTRRL HETKKCPDFS  240
CLKQPSPLNQ HQSWEKSSSY NGTSSMKVVA RGQVEDPSSH HSLANHSPKG NIIEESIVMR  300
RKLRPSATMG YQQNLLMLKE ASCNNNSNSS YLPNLAQNWD ISSAIAHSSF RPFTTMNPST  360
EIQLNGKLWG TGNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-13103156154Putative transcription factor PCF6
5zkt_B1e-13103156154Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00215DAPTransfer from AT1G67260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G112000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024444205.10.0transcription factor CYCLOIDEA
TrEMBLA0A2K1X6G00.0A0A2K1X6G0_POPTR; Uncharacterized protein
STRINGPOPTR_0017s13980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17383294
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.27e-29TCP family protein