PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G084600.2
Common NamePOPTR_0017s12080g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 432aa    MW: 47153.4 Da    PI: 4.849
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G084600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.48.9e-40148208262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  Potri.017G084600.2 148 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSA 208
                         7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30145205IPR003851Zinc finger, Dof-type
PfamPF027014.5E-32150206IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.817152206IPR003851Zinc finger, Dof-type
PROSITE patternPS013610154190IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MSEPKDQAFK LFGKTIQVPE ISVTTATTTD DDDDDDSQDQ DRPSCANSSL DETNITDDYN  60
NNDKRDHGEE DTETDDKDSV GKTTIENQED GASPVAAKES SNLDATSGTS ENPKTPSVEK  120
ESTALKTSNT EEEQSDTSNS QEKTLKKPDK IIPCPRCNSM DTKFCYYNNY NVNQPRHFCK  180
NCQRYWTAGG TMRNVPVGAG RRKNKNSASH YRHITIPEAL QNGRADVPNG VHHPSLKTNG  240
TVLTFGSDAP LHESMASVLN LADKTMRNCT MNGFHKPEAL RVPVSYGGGE NGDDHSNGSS  300
VTVSNSSDEA GKSVSKESAM QNYQGYPPQI PCFPGVPWPY PWNSAQWSSP VPPPAFCPSS  360
FPMPFYPAAA YWGCTVPGAW NVPWLPQPSS PKQTSSSSDP NSPTLGKHSR DENLLKPSNS  420
KEELVNTERC L*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.82740.0bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G084600.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323863.10.0cyclic dof factor 2
TrEMBLB9IJZ20.0B9IJZ2_POPTR; Uncharacterized protein
STRINGPOPTR_0017s12080.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-76cycling DOF factor 2