PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G082700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 162aa    MW: 17358.3 Da    PI: 6.2459
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G082700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.23.4e-3292148360
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                         +v+Y eC+kNhAa +Gg+avDGC+Efm+s geegtaaal+CaACgCHRnFHRreve+e
  Potri.017G082700.1  92 NVKYGECQKNHAAGVGGYAVDGCREFMAS-GEEGTAAALTCAACGCHRNFHRREVETE 148
                         799*************************9.999*********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-2088158IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.1E-3092145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.6E-2794145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.29495144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MEGLYISGLG LAVTTKSNFL LLSLLPLSIF TPYSNYRSVF QLENSSLAYQ GFEGEGSGEE  60
LGTSQMRKRQ VVVRRSEEPS RSSTTSSFTI RNVKYGECQK NHAAGVGGYA VDGCREFMAS  120
GEEGTAAALT CAACGCHRNF HRREVETEVA CDCSSPSSNG N*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.133120.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}.
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G082700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306048.18e-76mini zinc finger protein 2
SwissprotQ9LJW51e-44MIF2_ARATH; Mini zinc finger protein 2
TrEMBLB9H0F72e-74B9H0F7_POPTR; ZF-HD family protein
STRINGPOPTR_0004s12510.13e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.14e-29mini zinc finger 2
Publications ? help Back to Top
  1. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]