PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G081700.1
Common NamePOPTR_0017s11800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 307aa    MW: 34748.9 Da    PI: 6.7515
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G081700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.6e-1893145456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Potri.017G081700.1  93 KKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 145
                         4568889*********************************************9 PP

2HD-ZIP_I/II129.11.8e-4191182192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekk+rl+ eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdye+Lk+++dalk++n++L++++++L++el
  Potri.017G081700.1  91 EKKKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKKQFDALKADNDALQAQNKKLHAEL 181
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                          
  Potri.017G081700.1 182 L 182
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-1983149IPR009057Homeodomain-like
PROSITE profilePS5007116.95787147IPR001356Homeobox domain
SMARTSM003891.5E-1790151IPR001356Homeobox domain
CDDcd000869.58E-1692148No hitNo description
PfamPF000463.1E-1593145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-1995154IPR009057Homeodomain-like
PRINTSPR000311.1E-5118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5127143IPR000047Helix-turn-helix motif
PfamPF021831.4E-15147187IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MNERSFALSD HQHHMAFPPH HGFMFHSHED NDHHPSPSSL NSLPSCPPQL FPGSGGQFLM  60
KRSMSFSGME KCEEVGHGED DLSDDGSQIG EKKKRLNLEQ VKALEKSFEL GNKLEPERKM  120
QLAKALGLQP RQIAIWFQNR RARWKTKQLE KDYEVLKKQF DALKADNDAL QAQNKKLHAE  180
LLSLKSRESN EVNLKKETEG SWSNGSENSC DVNLDISRNP VASSPVSSQL TTKHLFSAPI  240
RPATITQLLQ GSSRSDLQCL KVDQLIHQDE NFCSMFNGIE EQQGFWPWPE QQHATFSLNQ  300
AQFSNN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.125180.0bud| catkin| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in flowers, and in the cortex of the root and the stem. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G081700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024444561.10.0homeobox-leucine zipper protein HAT7 isoform X1
SwissprotQ004661e-90HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLB9IJW40.0B9IJW4_POPTR; Uncharacterized protein
STRINGPOPTR_0017s11800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-82homeobox 3