PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G047300.1
Common NamePOPTR_0017s07460g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 245aa    MW: 27379.3 Da    PI: 10.5402
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G047300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF694.5e-221662349
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        i n+sn  vtfskRr g++KKA+EL++LC+aev++i+fs+  k++ +
  Potri.017G047300.1 16 IPNESNLMVTFSKRRSGLFKKASELCTLCGAEVSIIVFSPGKKVFSF 62
                        889*************************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.507666IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-29665IPR002100Transcription factor, MADS-box
CDDcd002651.06E-33783No hitNo description
SuperFamilySSF554551.07E-26778IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-17828IPR002100Transcription factor, MADS-box
PfamPF003195.0E-241562IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-172843IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-174364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MVRKSKGRQK LEMVKIPNES NLMVTFSKRR SGLFKKASEL CTLCGAEVSI IVFSPGKKVF  60
SFGHPSVEKV MERYLSGNIP QTSGAFHLIE AHRNARVHEL NMQLTQVANQ LEVEKKRGEE  120
LDRMRKASQS RNWWEKPLQE LDLAQLQQLR AALQDLKQDV TRHAKQILIQ NSAPQPFIAA  180
NPSTSGNHLF DTRNTGFISN MTVPPFNTNM SGTPFNTNMT ASPFNASSAM PPFGYSLGYG  240
TSFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A9e-16783177Myocyte-specific enhancer factor 2A
3kov_B9e-16783177Myocyte-specific enhancer factor 2A
3kov_I9e-16783177Myocyte-specific enhancer factor 2A
3kov_J9e-16783177Myocyte-specific enhancer factor 2A
3p57_A9e-16783177Myocyte-specific enhancer factor 2A
3p57_B9e-16783177Myocyte-specific enhancer factor 2A
3p57_C9e-16783177Myocyte-specific enhancer factor 2A
3p57_D9e-16783177Myocyte-specific enhancer factor 2A
3p57_I9e-16783177Myocyte-specific enhancer factor 2A
3p57_J9e-16783177Myocyte-specific enhancer factor 2A
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G047300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043074.11e-179PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLB9IJA60.0B9IJA6_POPTR; Uncharacterized protein
STRINGPOPTR_0017s07460.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-58AGAMOUS-like 62