PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G041500.1
Common NamePOPTR_0017s06900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 449aa    MW: 50283.4 Da    PI: 5.4346
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G041500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS281.13.2e-86444412373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lLl+cA a++++d +l+q++++ l++ as  gdp+qRl++ f++AL +r ++ +++ ++   +s+ +++++s +   l +++++ P+++
  Potri.017G041500.1  44 EKLLLHCASALEHNDGTLVQQVMWVLNNVASLVGDPNQRLTSWFLRALVSRASKVCPTAMDFDGSSTIRRRQMSVT--ELAVYVDLIPWHR 132
                         689***************************************************9999998777777765554444..33469******** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnv 180
                         f++ + N+aI +a+eg ++vHi+Df+i++++QWp+L++aLa+RpegppslRiT+ +   ++    + + ee+g rL++fA+  +vpfefnv
  Potri.017G041500.1 133 FGFCASNSAIFKAIEGYSKVHILDFSITHCMQWPTLIDALAKRPEGPPSLRITVPSCRPPVppfLNVSCEEVGLRLSNFAKFRDVPFEFNV 223
                         *****************************************************97775555668999************************ PP

                GRAS 181 l.....................vakrledleleeLrvkpgEalaVnlvlqlhrll.....desvsleserdevLklvkslsPkvvvvveqe 245
                         +                      ++ l+ l+++ L+++ +Eal++n++  l +l       +sv+ +s rd++L++vk  +P +v+vv+++
  Potri.017G041500.1 224 IddpsylasteimpkesshdfhFESLLNHLTPSVLNLRDDEALVINCQNWLRYLSnieqqGSSVQYSSLRDAFLRTVKAFNPCIVIVVDED 314
                         ***********998888777755556778899999*************999988755444566777779********************** PP

                GRAS 246 adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                         +d++++s+  r++ +++y +  fd+le+ lp++s++ri +E   +g +i+n+++ eg +r+er e   k +er+++aGF +vp+ e++  +
  Potri.017G041500.1 315 SDLSAPSLSSRITTCFNYLWIPFDALETFLPKDSSQRIEYESD-IGHKIENIISFEGLQRIERLEPGIKVSERMKNAGFFSVPFCEDTIGE 404
                         *******************************************.*********************************************** PP

                GRAS 337 aklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                         +++ll++++ ++g++   e++ l+l+Wk+++ v+++aW
  Potri.017G041500.1 405 VRSLLEEHAsGWGMKR-GEDHMLMLTWKGHNSVFATAW 441
                         *********5555543.4567889************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.82217422IPR005202Transcription factor GRAS
PfamPF035141.1E-8344441IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MKTELRGNTT SISLQNPSLF NTPQSSLSGA LKGCLGSLDG ACIEKLLLHC ASALEHNDGT  60
LVQQVMWVLN NVASLVGDPN QRLTSWFLRA LVSRASKVCP TAMDFDGSST IRRRQMSVTE  120
LAVYVDLIPW HRFGFCASNS AIFKAIEGYS KVHILDFSIT HCMQWPTLID ALAKRPEGPP  180
SLRITVPSCR PPVPPFLNVS CEEVGLRLSN FAKFRDVPFE FNVIDDPSYL ASTEIMPKES  240
SHDFHFESLL NHLTPSVLNL RDDEALVINC QNWLRYLSNI EQQGSSVQYS SLRDAFLRTV  300
KAFNPCIVIV VDEDSDLSAP SLSSRITTCF NYLWIPFDAL ETFLPKDSSQ RIEYESDIGH  360
KIENIISFEG LQRIERLEPG IKVSERMKNA GFFSVPFCED TIGEVRSLLE EHASGWGMKR  420
GEDHMLMLTW KGHNSVFATA WVPIDLQD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B5e-551644365474Protein SHORT-ROOT
5b3h_B1e-551644311420Protein SHORT-ROOT
5b3h_E1e-551644311420Protein SHORT-ROOT
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G041500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006373000.10.0scarecrow-like protein 32
TrEMBLU5FN460.0U5FN46_POPTR; Uncharacterized protein
STRINGPOPTR_0017s06900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100743142
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-126GRAS family protein