PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G037000.1
Common NamePOPTR_0017s06470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 75aa    MW: 8561.21 Da    PI: 4.0944
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G037000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.12.3e-092567145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        ++ ++++E+ l+ +  ++ G + W +Ia +++ gRt++++  +w 
  Potri.017G037000.1 25 KLEFSEDEETLITRMYNLVGER-WPLIAGRIP-GRTAEEIEKYWT 67
                        678*******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.9112070IPR017877Myb-like domain
SMARTSM007173.0E-72472IPR001005SANT/Myb domain
PfamPF002495.6E-82667IPR001005SANT/Myb domain
CDDcd001672.85E-62766No hitNo description
SuperFamilySSF466891.79E-82770IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-122768IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MADLDHSSSD DNSVDSREET SQDSKLEFSE DEETLITRMY NLVGERWPLI AGRIPGRTAE  60
EIEKYWTSRY STSQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.19481e-123bud
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in leaves primordia and later confined to trichomes. {ECO:0000269|PubMed:12356720}.
UniprotTISSUE SPECIFICITY: Expressed in trichomes and in young developing leaves, as well as in root hair and stele cells (pericycle and vascular tissues). Expressed in epidermal root hairless cells (atrichoblasts) and moves to root hair cells (trichoblasts) by a cell-to-cell movement through plasmodesmata (at protein level). {ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16291794}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:16291794, ECO:0000269|PubMed:19513241, ECO:0000269|PubMed:9262483}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G037000.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptional repression correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in root epidermis N cells (non-hair developing cells). Induced by WER. Negative autoregulation by interfering with the binding of WER to its WER-binding sites (WBS) promoter region, especially in H cells. Down-regulated by GEM. Down-regulated by TMM (PubMed:19513241). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16176989, ECO:0000269|PubMed:16207757, ECO:0000269|PubMed:17450124, ECO:0000269|PubMed:19513241}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372948.11e-47transcription factor CPC
SwissprotO220591e-16CPC_ARATH; Transcription factor CPC
TrEMBLB9MXY42e-46B9MXY4_POPTR; Uncharacterized protein
STRINGPOPTR_0017s06470.14e-47(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Representative plantOGRP3921825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.19e-19MYB_related family protein
Publications ? help Back to Top
  1. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  2. Nayidu NK, et al.
    Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae.
    PLoS ONE, 2014. 9(4): p. e95877
    [PMID:24755905]
  3. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  4. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
    Front Plant Sci, 2015. 6: p. 955
    [PMID:26579186]
  5. Tominaga-Wada R,Wada T
    The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis.
    J. Plant Physiol., 2016. 199: p. 111-115
    [PMID:27302012]
  6. Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
    The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells.
    Plant J., 2016. 88(5): p. 762-774
    [PMID:27496682]
  7. Tominaga-Wada R,Kurata T,Wada T
    Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis.
    J. Plant Physiol., 2017. 214: p. 48-52
    [PMID:28437677]
  8. Tominaga-Wada R,Kurata T,Wada T
    Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis.
    Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767
    [PMID:28644769]
  9. Tominaga-Wada R,Wada T
    Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
    Development, 2017. 144(13): p. 2375-2380
    [PMID:28676568]
  10. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]
  11. Tominaga-Wada R,Wada T
    Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis.
    Dev. Biol., 2018. 435(1): p. 1-5
    [PMID:29337129]
  12. Kohanová J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]