PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G029400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 287aa    MW: 32877.5 Da    PI: 7.5239
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G029400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR183.53.6e-26121209290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         fY+eYA+++GF +r+ + ++s+r+g+i  r++ C+keg+  + + k  + r++r++tr gCka+++vk +k+gkw++tk++++HnH+l+
  Potri.017G029400.1 121 FYDEYARRIGFVMRVMSCRRSERDGRILARRLGCNKEGYCVSIRGKFGNVRKPRPSTREGCKAMIHVKFDKSGKWVITKFVKDHNHPLV 209
                         9**************************************999999989***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.2E-24121209IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSFMIKTTCC QIYSCLSGGI KTLEFHDHLS LDSDPSYPYS PKPKNTSLNS RNYLTYPSQF  60
RVSLIFAASM DVDERIDIAE SSIGNELVEH GGELVEHEGD DMVVEPHEGM EFESEDAAKI  120
FYDEYARRIG FVMRVMSCRR SERDGRILAR RLGCNKEGYC VSIRGKFGNV RKPRPSTREG  180
CKAMIHVKFD KSGKWVITKF VKDHNHPLVV APREARQTLD EKDKKIQELT AELRNKKRLC  240
ATYQEQLSAF VKIVEDHSEK LSKKVKNAVE NLKEFESIEQ ELMQHT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G029400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2146280.0AC214628.1 Populus trichocarpa clone POP040-F15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024444552.11e-159protein FAR1-RELATED SEQUENCE 5
RefseqXP_024448822.11e-159protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A3N7G3V31e-158A0A3N7G3V3_POPTR; Uncharacterized protein
STRINGPOPTR_0017s05820.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-112FAR1 family protein