PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G029100.2
Common NamePOPTR_0017s05780g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 206aa    MW: 23545.9 Da    PI: 9.8862
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G029100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR193.33.1e-2941128291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fYn+YA+++GF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gkwevtk+++eH+H+l+p
  Potri.017G029100.2  41 FYNAYATRIGFVIRVSKLSRSRRDGSAIGRALVCNKEGFRMPDKRE--KIVRQRAETRVGCRAMILVRKASSGKWEVTKFVKEHTHSLTP 128
                         ******************************************9988..9**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-2641128IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MDKESLAIDM IPDAVPAMSM VAADEPYMGQ EFDSEASAHA FYNAYATRIG FVIRVSKLSR  60
SRRDGSAIGR ALVCNKEGFR MPDKREKIVR QRAETRVGCR AMILVRKASS GKWEVTKFVK  120
EHTHSLTPGK ARRDCIYDQY PNEHDKIREL SQQLALEKKR AATYKRHLEL IFEQIEEHNE  180
SLSKKIQHIV HSVRGMENKP QQSQT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G029100.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2146280.0AC214628.1 Populus trichocarpa clone POP040-F15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372863.21e-153protein FAR-RED ELONGATED HYPOCOTYL 3
RefseqXP_024448818.11e-153protein FAR-RED ELONGATED HYPOCOTYL 3-like isoform X1
RefseqXP_024448819.11e-153protein FAR-RED ELONGATED HYPOCOTYL 3-like isoform X2
SwissprotQ9SZL81e-25FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2K1R5Z11e-151A0A2K1R5Z1_POPTR; Uncharacterized protein
TrEMBLA0A2K1X2E71e-152A0A2K1X2E7_POPTR; Uncharacterized protein
STRINGPOPTR_0017s05780.11e-152(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-113FAR1 family protein
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]