PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G019900.1
Common NamePOPTR_0017s05450g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 442aa    MW: 49678.2 Da    PI: 5.1614
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G019900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS321.81.4e-98694403374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lL ecA+a+s++d +++++lL+ l+elasp+gd  q+la+yf++AL  + ++s+++++k+l++ ++++++ +++ +    f+evsP+ +f
  Potri.017G019900.1  69 KLLSECARAISEKDSSKIHHLLWMLNELASPYGDCDQKLASYFLQALFCKATESGQRCFKTLTTVAEKSHSFDSARKLILKFQEVSPWTTF 159
                         799***********************************************************9999985554444444445********** PP

                GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl.va 183
                         +h++ N aIlea++ge+++HiiD++ + ++QWp+Ll+aLa+R++++p+l++T+v+  +s  +  ++e+g+r++kfA+ +gvpfef+v+ v 
  Potri.017G019900.1 160 GHVASNGAILEALDGESKLHIIDISNTLCTQWPTLLEALATRNDETPRLKLTVVVT-ASIVRSVMKEIGQRMEKFARLMGVPFEFKVIsVL 249
                         ********************************************************.557999*************************888 PP

                GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse..sFlerflealeyysalfdsle 272
                         +++ +l+ e L v+++Ea+a+n++ +l r+        +er++v++l++sl+P+vv++ve+ead +s+  +F++ f e+l+yy+  f++le
  Potri.017G019900.1 250 NHIGELTKEGLGVQEDEAVAINCIGALRRVE------VDERSSVIQLFRSLNPRVVTIVEEEADFTSSryDFVKCFEECLRYYTLYFEMLE 334
                         8****************************97......334779*********************9665459******************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegae...rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve....eesg 356
                         +++ ++s+er ++Ere  +r+iv v+ac ++      er+e+  +W+erl+ea F+pv +s+++++++k+ll+++k  g+ +     +++ 
  Potri.017G019900.1 335 ESFVPTSNERLMLERE-CSRNIVRVLACDEETgggECERRERGVQWSERLREA-FSPVGFSDDVVDDVKALLKRYK-AGWALVlpqgDHES 422
                         ****************.89*********9876555799*************98.**********************.66666655655677 PP

                GRAS 357 slvlgWkdrpLvsvSaWr 374
                          ++l+Wk++p+v++SaW+
  Potri.017G019900.1 423 GIYLTWKEEPVVWASAWK 440
                         778**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.58341417IPR005202Transcription factor GRAS
PfamPF035144.9E-9669440IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MDITLFSPKD TLTHFFPSHQ QSNDQVAAID MQSNSSNNNN NQPQTSHTST SRSSDSGEAC  60
GGGNKWASKL LSECARAISE KDSSKIHHLL WMLNELASPY GDCDQKLASY FLQALFCKAT  120
ESGQRCFKTL TTVAEKSHSF DSARKLILKF QEVSPWTTFG HVASNGAILE ALDGESKLHI  180
IDISNTLCTQ WPTLLEALAT RNDETPRLKL TVVVTASIVR SVMKEIGQRM EKFARLMGVP  240
FEFKVISVLN HIGELTKEGL GVQEDEAVAI NCIGALRRVE VDERSSVIQL FRSLNPRVVT  300
IVEEEADFTS SRYDFVKCFE ECLRYYTLYF EMLEESFVPT SNERLMLERE CSRNIVRVLA  360
CDEETGGGEC ERRERGVQWS ERLREAFSPV GFSDDVVDDV KALLKRYKAG WALVLPQGDH  420
ESGIYLTWKE EPVVWASAWK P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-34714408375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2176430.0AC217643.1 Populus trichocarpa clone POP035-K18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372828.10.0hypothetical protein POPTR_0017s05450g
SwissprotQ9SZF71e-147SHR_ARATH; Protein SHORT-ROOT
TrEMBLU5FI430.0U5FI43_POPTR; Uncharacterized protein
STRINGPOPTR_0017s05450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP27551332
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-139GRAS family protein