PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.017G016900.1
Common NamePOPTR_0017s04820g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 180aa    MW: 20296.9 Da    PI: 8.2521
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.017G016900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.1e-182174457
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        + ++ ++ql+ Le+ F+ n++++ae+++eLA++lg++ +qV +W+qNrRa++k+
  Potri.017G016900.1 21 KKRLARDQLNLLETSFNANQKLKAEHKTELARQLGVPPKQVAIWYQNRRARHKN 74
                        456899**********************************************95 PP

2HD-ZIP_I/II95.84.4e-3120111293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +k+rl+++q++lLE+sF++++kL+ e+K+elar+Lg+ p+qva+W+qnrRAR+k+  +E+dy  ++ ++ ++ +en rLek+v+ L+ el+
  Potri.017G016900.1  20 RKKRLARDQLNLLETSFNANQKLKAEHKTELARQLGVPPKQVAIWYQNRRARHKNDAIEHDYMNIQLELGNVFAENIRLEKQVSMLKFELN 110
                         89************************************************************************************99887 PP

         HD-ZIP_I/II  93 e 93 
                         +
  Potri.017G016900.1 111 K 111
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.74E-16774IPR009057Homeodomain-like
PROSITE profilePS5007115.9041575IPR001356Homeobox domain
SMARTSM003893.7E-151879IPR001356Homeobox domain
PfamPF000469.9E-162074IPR001356Homeobox domain
CDDcd000867.11E-142074No hitNo description
Gene3DG3DSA:1.10.10.601.3E-172381IPR009057Homeodomain-like
PRINTSPR000311.8E-54655IPR000047Helix-turn-helix motif
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PRINTSPR000311.8E-55571IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MNSHLHHQSQ SQGNRPLKPR KKRLARDQLN LLETSFNANQ KLKAEHKTEL ARQLGVPPKQ  60
VAIWYQNRRA RHKNDAIEHD YMNIQLELGN VFAENIRLEK QVSMLKFELN KVQQMILFGP  120
TSSAATLPSV SGSSDEQANS SSPGNMICNW GDAGNDDMFP VEELYTCLIG SDTQLWPLN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.017G016900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372763.11e-133homeobox-leucine zipper protein ATHB-52
TrEMBLU5FHZ51e-132U5FHZ5_POPTR; Uncharacterized protein
STRINGPOPTR_0017s04820.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1653559
Representative plantOGRP1636623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.16e-20homeobox protein 52