PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G143900.1
Common NamePOPTR_0016s15060g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 770aa    MW: 84142.5 Da    PI: 6.6949
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G143900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS412.34.5e-1263767332374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lLl+cAeavs++++e+a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y++lp+ ++s  ++++ ++a+++f+ + P++k
  Potri.016G143900.1 376 LTLLLQCAEAVSADNFEEANKMLLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYATLPSMPQS--HTQKMASAFQVFNGIGPFVK 464
                         579************************************************************999998..5899999************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                         fsh+taNqaI ea+e+eervHiiD+d++qGlQWp L++ LasRp+gpp +R+Tg+g     s e+le+tg+rL++fA++lg+pfef + va
  Potri.016G143900.1 465 FSHFTANQAIQEAFEREERVHIIDLDVMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SLEALEATGKRLSDFAHKLGLPFEFIP-VA 550
                         *********************************************************....9**************************.7* PP

                GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                         +++ +le+e+L+v+++Ea+aV++    h+l+d ++s ++    +L l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a+
  Potri.016G143900.1 551 EKVGNLEPERLNVSKREAVAVHWLQ--HSLYDVTGSDTN----MLCLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGAS 634
                         ************************9..999999999999....**********************.899********************** PP

                GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                         +++eseer++vE++ll+rei+nv+a  g +r  + + +++Wre+l+++GFk ++l  +aa+qa lll +++sdgy++ e++g+l lgWkd 
  Potri.016G143900.1 635 YGEESEERHVVEQQLLSREIRNVLAVGGPSRSGDVK-FHNWREKLQQSGFKGISLAGNAATQATLLLGMFPSDGYTLVEDNGTLKLGWKDL 724
                         ******************************888877.****************************************************** PP

                GRAS 366 pLvsvSaWr 374
                          L+++SaWr
  Potri.016G143900.1 725 CLLTASAWR 733
                         ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.276349713IPR005202Transcription factor GRAS
PfamPF035141.6E-123376733IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MTRSTGASSF TSCSNNNNIN PNNPNSILYP VLNYSTTTSM LPSSTNLTAI TSGVSASLSV  60
SEFLSPTVLS TNLITSCNDT HTQSQLPAVC GFSGLPLFPP AEIKRNNIRS NAAADPPPGL  120
ITTSITAPTT STLASASMED ATSATAWIDG LIKDLLHTST NVSIPQLIQN VREIIYPCNP  180
NLASLLEYRL RSLTDPIIPP NILPVERSRN KEAAAAVPLP LQIQRRCNQG HASNSGLTLD  240
LDNIVSNSAP PVSSHVSHYS NWGPTPPLIC QPNIQQQHQQ PQIHLVHHDQ HLQQQKQKQQ  300
ESPSSTSNVT PTILAINQGQ PPQQQAQDQQ QEKSSSAETE QVSSSTSPPS SSAAASRDKK  360
EEMRQQKRDE EGLHLLTLLL QCAEAVSADN FEEANKMLLE ISELSTPFGT SAQRVAAYFS  420
EAMSARLVSS CLGIYATLPS MPQSHTQKMA SAFQVFNGIG PFVKFSHFTA NQAIQEAFER  480
EERVHIIDLD VMQGLQWPGL FHILASRPGG PPYVRLTGLG TSLEALEATG KRLSDFAHKL  540
GLPFEFIPVA EKVGNLEPER LNVSKREAVA VHWLQHSLYD VTGSDTNMLC LLQRLAPKVV  600
TVVEQDLSHA GSFLGRFVEA IHYYSALFDS LGASYGEESE ERHVVEQQLL SREIRNVLAV  660
GGPSRSGDVK FHNWREKLQQ SGFKGISLAG NAATQATLLL GMFPSDGYTL VEDNGTLKLG  720
WKDLCLLTAS AWRPFHVTIE TATTTPHHHH HHHHHQQQQQ HHHHRFVTA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-503757334375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323112.20.0hypothetical protein POPTR_0016s15060g
SwissprotQ9M3840.0SCR_ARATH; Protein SCARECROW
TrEMBLB9IGZ80.0B9IGZ8_POPTR; Uncharacterized protein
STRINGPOPTR_0016s15060.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21831437
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein