PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G118900.1
Common NamePOPTR_0016s12640g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 196aa    MW: 22558.6 Da    PI: 8.458
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G118900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.91.1e-222974247
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                        +++ +snr+vtfskR+ng++KKA ELS+LC+ae avi+fs++ kl+
  Potri.016G118900.1 29 KVQKESNRYVTFSKRKNGLFKKATELSTLCGAETAVIVFSEHRKLF 74
                        56789************************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.7962080IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-282079IPR002100Transcription factor, MADS-box
CDDcd002651.02E-322189No hitNo description
SuperFamilySSF554551.7E-262190IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-202242IPR002100Transcription factor, MADS-box
PfamPF003191.5E-222975IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-204257IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-205778IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MDATDSNRQR HQQETRRTSK GRQKIEIKKV QKESNRYVTF SKRKNGLFKK ATELSTLCGA  60
ETAVIVFSEH RKLFSCGQPD VDKVLDRYLV ETEKVPSNFP PVTNNNIESQ LANKQEYARS  120
LKRLEEEQTV AKMIGNMNDM NEGGFWWDLP IDNMEQDELE AYKESMEQLK KNVITRLGLI  180
EANNAPTTVI CERKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A5e-182188168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_B5e-182188168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_C5e-182188168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_D5e-182188168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
3kov_A6e-182188168Myocyte-specific enhancer factor 2A
3kov_B6e-182188168Myocyte-specific enhancer factor 2A
3kov_I6e-182188168Myocyte-specific enhancer factor 2A
3kov_J6e-182188168Myocyte-specific enhancer factor 2A
3mu6_A5e-182188168Myocyte-specific enhancer factor 2A
3mu6_B5e-182188168Myocyte-specific enhancer factor 2A
3mu6_C5e-182188168Myocyte-specific enhancer factor 2A
3mu6_D5e-182188168Myocyte-specific enhancer factor 2A
3p57_A6e-182188168Myocyte-specific enhancer factor 2A
3p57_B6e-182188168Myocyte-specific enhancer factor 2A
3p57_C6e-182188168Myocyte-specific enhancer factor 2A
3p57_D6e-182188168Myocyte-specific enhancer factor 2A
3p57_I6e-182188168Myocyte-specific enhancer factor 2A
3p57_J6e-182188168Myocyte-specific enhancer factor 2A
6bz1_A8e-182188269MEF2 CHIMERA
6bz1_B8e-182188269MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G118900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002323594.21e-137agamous-like MADS-box protein AGL62
RefseqXP_024443414.11e-137agamous-like MADS-box protein AGL62
RefseqXP_024443416.11e-137agamous-like MADS-box protein AGL62
TrEMBLA0A2K1XEI51e-143A0A2K1XEI5_POPTR; Uncharacterized protein
STRINGPOPTR_0016s12640.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.18e-36AGAMOUS-like 62