PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G117300.1
Common NamePOPTR_0016s12470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 280aa    MW: 33431.1 Da    PI: 9.6921
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G117300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.71.7e-2439121186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W+ qe+++ + +r e++ ++ ++k++k lWe +s+km+e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  Potri.016G117300.1  39 QWSIQETKEFLMIRAELDPTFMEKKRNKVLWEVISNKMKEKGYNRSAEQCKCKWKNLFTRYKGCETIEPEA---MRQQFPFYNELQ 121
                         7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00733698IPR001005SANT/Myb domain
CDDcd122034.08E-2338103No hitNo description
PfamPF138371.6E-2039123No hitNo description
PROSITE profilePS500907.3294096IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEGHLHHQHH NQHHLQQYQL LQQQHHISVN VEASDKFPQW SIQETKEFLM IRAELDPTFM  60
EKKRNKVLWE VISNKMKEKG YNRSAEQCKC KWKNLFTRYK GCETIEPEAM RQQFPFYNEL  120
QAIFTSRMQR MLRAEAEGAA TGLKKKAVKL SSDDEDKNEE IIEGEKGGSR KKIKKGKAIG  180
GTSSSGNSIS LKESLEDFTK QQIQMEMQWR EVFEARENER MMKEMEWRQT MKQLENDRIV  240
MERRWREREE QRRVREEARA EKRDALITAL LNKLRREDM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322985.10.0hypothetical protein POPTR_0016s12470g
SwissprotQ9SDW07e-71TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLB9IGA40.0B9IGA4_POPTR; Uncharacterized protein
STRINGPOPTR_0016s12470.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22621535
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.17e-56Trihelix family protein