PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G091700.3
Common NamePOPTR_0016s09290g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 754aa    MW: 83744.1 Da    PI: 7.4595
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G091700.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.31.7e-084991347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
  Potri.016G091700.3 49 AWTRQEEESFFTALRQVGKN-FEKITHHVQ-SKNKDQVRHYYYRL 91
                        6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-113296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-54494IPR009057Homeodomain-like
PROSITE profilePS5129314.5644596IPR017884SANT domain
SMARTSM007179.0E-74694IPR001005SANT/Myb domain
CDDcd001671.75E-64992No hitNo description
PfamPF002492.1E-64991IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MEAQVSLDSE RQLLQNGSIQ DGDSGVTSST PDCVETRQPE KRPTRQWAAW TRQEEESFFT  60
ALRQVGKNFE KITHHVQSKN KDQVRHYYYR LVRRMNKLLG PGLCLDAKNS KDTNAAMLRW  120
WSLLEKYSCK ASKLHLKPRR FKIFIEALEN QLLKDQRKNV RKRSSQGENG SPTTPSIITN  180
QNRASVHDTR TVKLVIVDSQ NIQKLGGKGS LKRNVNMGVV RNNNKGDSTA MKPARQRRKP  240
AAYKKWEKAA IAGVSLVADA AEHLERTATD KEDEHDQGMV GKKGLDPVEK LLPHFHPSLR  300
CVESNALTNM KLKLQLFPID DGTRRALEMD KHNPHLELTL STRKKISSVL EHLNRKWGDS  360
TVASGELMLF PYSVNRENLV SYQRWTQDSL VSAADVYFSI GSPPVFRLRY GWFFNVNFAS  420
VTLQAPSTYS CLPVGGNEKD KTMDSVPTAE PSTSDQFEKP ENPCRDCPTS ENNNHASILH  480
SAGVTNENNE FVATGPRNNL VKLSNVNPLS AGEWADSLTN VSIGDLLSEL PHVANHNCIE  540
SLIVQSNQCL QEIPFSCDSF DAAIAAHISR HQGKMGFHSA VASYTSSIWD GEETCDAFAF  600
QKNHSLRKEV TTSSAVASPR KGGLIKGNVF TLVLQELPVI EGPNDYPTGG EPMDECSSDS  660
QVVSNQVKDF NGLTDIYWPD SLGLLDLDIP SSKYHTEDLI LSDSLGGLNH LIASSLDAFQ  720
NCSFFGLNKK DSISTVEARE TTSFSDFKIS GGV*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers, roots and leaves. {ECO:0000269|PubMed:15047893}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G091700.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024443873.10.0TSL-kinase interacting protein 1 isoform X2
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A2K1XD360.0A0A2K1XD36_POPTR; Uncharacterized protein
STRINGPOPTR_0016s09290.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.30.0TSL-kinase interacting protein 1