PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G059100.1
Common NamePOPTR_0016s05900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 635aa    MW: 72139.4 Da    PI: 4.5141
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G059100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR131.46.1e-102152505490
                FAR1  54 traetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +r+etrtgC+ak++ + e +gkw++++++leHnH+l 
  Potri.016G059100.1 215 KRKETRTGCNAKIHCTVE-NGKWVISQVSLEHNHPLE 250
                         689**************9.****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.0E-7215250IPR004330FAR1 DNA binding domain
PfamPF105515.3E-22360454IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MAETLDLNSG PDLSTSPTDP SRPSDVNFWY QILTSYQEDL QHTLRPSTSR LDSEWGHVFD  60
KSSKKKRQRM DTNSGAGSGV NSASDLSEAL SAVSAALSLS SSASSGVKDQ WEKEGAEFIR  120
KGVEELQDEM VDNSNENPIS LDIQSLPSES SEDDVLLSDS NENNSEIPAT WAFEANGETW  180
QGNSQVPELG MVFSSEEEAY EFYKSYAGEI GFNYKRKETR TGCNAKIHCT VENGKWVISQ  240
VSLEHNHPLE DRRRVIGSHT KTNSEAPLMI CTDNEAEMAK DVGNKGVQSS NMGCTVCVPD  300
KRINSLQPEA AQCLLNYFRR LQVEDLSFFY AVQLDSNGYT TNFLWRDGRS KVDYDYFGDV  360
LILDKTFRIE EHTIICAPLW GLNHHRQQVL FGCAFLLNES TDSFVWLLET FMEAMDRHQP  420
KTIFTDENEL MVDAVKAVLP DAEHRIGIWY IRQNALKQLS ALYMQPGFEI LFNKCISDCQ  480
TEEEFESRWE SLLERFDLSE NPWLSSLYKS RERWACVLIK KTFCAGLQHG ENIKSVFQIP  540
KNENTGLLEF AQQYLEVVKR RRLEELDEDF HCNGTAQVTI LTSSAIERQA ADMYTRTLFK  600
TFQEEFLKCL SVTIEETASN ETITTYKLTE EGHK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16368KKKRQR
2558562KRRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G059100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039464.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X2
TrEMBLA0A3N7HX530.0A0A3N7HX53_POPTR; Uncharacterized protein
STRINGPOPTR_0016s05900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.18e-77FAR1-related sequence 5