PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G059000.1
Common NamePOPTR_0016s05890g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 345aa    MW: 38311.9 Da    PI: 9.0443
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G059000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.3e-17175229256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Potri.016G059000.1 175 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 229
                         778899***********************************************98 PP

2HD-ZIP_I/II127.94.3e-41175265192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Potri.016G059000.1 175 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-AL 264
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  Potri.016G059000.1 265 K 265
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-18167232IPR009057Homeodomain-like
PROSITE profilePS5007116.86171231IPR001356Homeobox domain
SMARTSM003895.4E-15173235IPR001356Homeobox domain
CDDcd000862.62E-15175232No hitNo description
Gene3DG3DSA:1.10.10.605.0E-17175229IPR009057Homeodomain-like
PfamPF000464.4E-15175229IPR001356Homeobox domain
PROSITE patternPS000270206229IPR017970Homeobox, conserved site
SMARTSM003404.5E-26231274IPR003106Leucine zipper, homeobox-associated
PfamPF021837.0E-11231265IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MELALSLGDT SKPFKFLDKT PKLSSKDLGF CMGLGSGFPA TTRSQDKLGS HESNYQDDER  60
RVSSDPPLQL DLLPFSPVPR GHQAPSRIRF PWLTDNLVSE PGSTEAPGRR FDVNRLSMDD  120
ADEGAAISSP NSAASSFQMD FGIRSGRDRK RDLDAIDAER ASSRASDDDE NGLTRKKLRL  180
SKEQSAFLEE SFKEHNTLNP KQKLALAKQL NLRPRQVEVW FQNRRARTKL KQTEVDCEYL  240
KRCCETLTEE NRRLQKELQE LRALKTSQPF YMQLPATTLT MCPSCERVAT TTTSSSGTTT  300
TTTTTNPSTT TTTSTTSSKP LSLPAKPRLF PLSHGQVQPH HAAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173179TRKKLRL
2223231RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.116100.0bud
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G059000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM2629441e-150AM262944.1 Phillyrea latifolia partial mRNA for type II homeodomain-leucine zipper protein precursor (ophh-61B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322729.20.0homeobox-leucine zipper protein HOX11
SwissprotP466651e-103HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9IIA10.0B9IIA1_POPTR; HD-ZIP family protein
STRINGPOPTR_0016s05890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-79homeobox from Arabidopsis thaliana