PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G058700.1
Common NamePOPTR_0149s00230g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 626aa    MW: 72679.9 Da    PI: 7.447
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G058700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR173.35.4e-2345131190
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         kfY +YA+++GF++rk k ++   ng+i kr + Csk+g+r +++ + + ++ +r+etrtgC+ak++ + e +gkw+v+++++eHnH+l 
  Potri.016G058700.1  45 KFYTSYANKIGFRTRKGKVQRL-SNGTIRKRFLFCSKQGFRLKKQAD-KITKYKRKETRTGCDAKIQFSVE-NGKWVVSQFSQEHNHHLE 131
                         6*****************9998.7888****************9999.99999*****************9.***************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.1E-2045131IPR004330FAR1 DNA binding domain
PfamPF105511.0E-23230323IPR018289MULE transposase domain
PROSITE profilePS509669.47502540IPR007527Zinc finger, SWIM-type
PfamPF044341.0E-5514540IPR007527Zinc finger, SWIM-type
SMARTSM005759.9E-7515542IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MLSSDSNEDE DEIQATSVFG ASESKDSCQK PEVGMEFSSE EEAYKFYTSY ANKIGFRTRK  60
GKVQRLSNGT IRKRFLFCSK QGFRLKKQAD KITKYKRKET RTGCDAKIQF SVENGKWVVS  120
QFSQEHNHHL EDRRHITRSC TKTSEAHLIH TGNNAQMAMD AGAPKCTELC NMVWSTHPKE  180
VQILLNYLRR LQVEDLSLFY AVQLDSDNRL KNLFWRDGRS MVDYDYFGDV LILDTTFRMD  240
KYEMICAPFW GLNHHRQYVM FGCAFLLDES KESFVWLFET FLEAMGRKQP KTIVTDENQV  300
MVDAVKVVLL DAEHLFGVWF IRQKALKHLS AFYSQPDFVN IFNECVSYCQ NEEEFESKWD  360
FLLKKFNLCE NAWLNNLYLS RERWANVFHK KTFSAGIRWC NDNVNVFQNS TSDTMDLSMF  420
VHQYLKVVET QRSAELNEDM RCRETTKVLS SSAMEKQAAN IYTRTIFKIF QEELITCLSV  480
AIEEIASDGT NATFKLTEEG QKESIVEFSC LDSNLACSCR KYESEGILCV HALKVLNARN  540
VFRIPDQYML KRWTKCAKDS VPEDEHVQKL AGQKQQPMSL LLKKALDVIY KTSAFEDCQK  600
IAMHYLDEAS KKVEAALRSK KHRSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G058700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024443203.10.0protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2K1XBC70.0A0A2K1XBC7_POPTR; Uncharacterized protein
STRINGPOPTR_0149s00230.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-109FAR1-related sequence 5