PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G058600.1
Common NamePOPTR_0149s00220g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 204aa    MW: 23012.1 Da    PI: 10.4061
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G058600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.83.2e-173387256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        rk+ +++k q   Lee F++++ ++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Potri.016G058600.1 33 RKKLRLSKGQSAFLEESFKEHNILNPKQMLALAKQLNLRPRQVEVWFQNRRARTK 87
                        6788899**********************************************98 PP

2HD-ZIP_I/II123.41.1e-3933123192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlsk q+++LEesF+e++ L+p++  +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Potri.016G058600.1  33 RKKLRLSKGQSAFLEESFKEHNILNPKQMLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-AL 122
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  Potri.016G058600.1 123 K 123
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-172490IPR009057Homeodomain-like
PROSITE profilePS5007116.0662989IPR001356Homeobox domain
SMARTSM003891.3E-123193IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-163387IPR009057Homeodomain-like
CDDcd000861.41E-113390No hitNo description
PfamPF000461.0E-143387IPR001356Homeobox domain
PROSITE patternPS0002706487IPR017970Homeobox, conserved site
SMARTSM003404.5E-2689132IPR003106Leucine zipper, homeobox-associated
PfamPF021833.3E-1189123IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MKRERTKLKQ TEAIDAERAS SRASDDDENG LTRKKLRLSK GQSAFLEESF KEHNILNPKQ  60
MLALAKQLNL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR CCETLTEENR RLQKELQELR  120
ALKTSQPFYM QLPATTLTMC PSCERVATTT TSSSGTTTTT TTNPSTTTTT TTSTTNSKPL  180
SLPAKPRLFP LSHGQVQPHH AAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13137TRKKLRL
28189RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.116100.0bud
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G058600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM2629441e-161AM262944.1 Phillyrea latifolia partial mRNA for type II homeodomain-leucine zipper protein precursor (ophh-61B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024443964.11e-146homeobox-leucine zipper protein HOX27
SwissprotP466657e-80HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLU7DZ361e-145U7DZ36_POPTR; Uncharacterized protein
STRINGPOPTR_0149s00220.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-80homeobox from Arabidopsis thaliana