PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G058500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 715aa    MW: 81170.7 Da    PI: 4.6251
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G058500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR127.11.4e-081922275490
                FAR1  54 traetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         +r+et+tgC+ak+    e +gkw++++++leHnH+l 
  Potri.016G058500.1 192 KRKETQTGCDAKIPCAVE-NGKWVISQVSLEHNHPLE 227
                         6899************99.****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-6192227IPR004330FAR1 DNA binding domain
PfamPF105511.1E-21337431IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MAETLDLNSG PDLSTSPTDP SQPSDANFWY QILTSNQEDL QHTLRPSTSR LDSEWGHVFD  60
KSSKKKRQRM DTNSGAGSGV NSASDLSEAL SAVSAALSLS SSASSGMVDN SNENPISFDI  120
QSLPSESSED DVPLSDSNEN NSEIPSTWAS EANGETWKSN SQVPELGMVF SSEEEAYEFY  180
KSYADEIGFN YKRKETQTGC DAKIPCAVEN GKWVISQVSL EHNHPLEDRR RVIGSHTKTN  240
SEAPLMICTD NEAEMAKDVG NKGVQSSNMG CTVCVPDKRI NSLQPEAAQC LLNYFRRLQV  300
EDLSFFYAVQ LDSNGYTTNF FWRDGRSKVD YDYFGDVLIL DKTFRIEEHN IICAPLWGLN  360
HHRRQVLFGC AFLLNESTDS FVWLLETFME AIDRHQPKTI FTDENELMVD AVKAVLPDAE  420
HRIGIWYIRQ NALKQLSALY MQPGFEILFN KCISDCQTEE EFESRWESLL ERFDLSENPW  480
LSSLYTSRER WACVLIKKTF CAGLQHGENI ESVFQILQNE NTGLLEFAQQ YLEVVKRRRL  540
EELDEDFHCN GTAQVTILTG SAIERQAADI YTRTLFKTFQ DEFLNCLSVT IEETASNETI  600
TTYKLTEEGH KESVLNARNI FHIPHKYVLK RWTKSAKCGV PYEYQQEMAD EMKQQTVNLL  660
MHKTLNVFTK SVAIEDSKKI AGDYLGKTLE QIEDVLRAKK ADHLEMIDRS RGMI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16368KKKRQR
2535539KRRRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G058500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011016615.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X2
RefseqXP_011039463.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X1
RefseqXP_011039464.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X2
TrEMBLA0A3N7G3J00.0A0A3N7G3J0_POPTR; Uncharacterized protein
STRINGPOPTR_0016s05900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-80FAR1-related sequence 5