PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G058400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 145aa    MW: 16280.6 Da    PI: 10.5283
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G058400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox375.8e-123312856
                        HHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox 28 eereeLAkklgLterqVkvWFqNrRakek 56
                        +++  LAk+l+L  rqV vWFqNrRa+ k
  Potri.016G058400.1  3 KQKLALAKQLNLRPRQVEVWFQNRRARTK 31
                        67789**********************98 PP

2HD-ZIP_I/II933.3e-303672792
         HD-ZIP_I/II 27 erKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92
                        ++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  Potri.016G058400.1  3 KQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 67
                        89***********************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007112.908133IPR001356Homeobox domain
CDDcd000868.56E-7234No hitNo description
Gene3DG3DSA:1.10.10.609.2E-11336IPR009057Homeodomain-like
PfamPF000462.1E-9331IPR001356Homeobox domain
SuperFamilySSF466891.37E-10342IPR009057Homeodomain-like
PROSITE patternPS000270831IPR017970Homeobox, conserved site
SMARTSM003404.5E-263376IPR003106Leucine zipper, homeobox-associated
PfamPF021831.8E-113367IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MQKQKLALAK QLNLRPRQVE VWFQNRRART KLKQTEVDCE YLKRCCETLT EENRRLQKEL  60
QELRALKTSQ PFYMQLPATT LTMCPSCERV ATTTTSSSGT TTTTTTTNPS TTTSTTSSKP  120
LSLPAKPRLF PLSHGQVQPH HAAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12533RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.116100.0bud
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G058400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM2629441e-147AM262944.1 Phillyrea latifolia partial mRNA for type II homeodomain-leucine zipper protein precursor (ophh-61B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024443766.11e-99homeobox-leucine zipper protein HOX11-like
SwissprotP466653e-57HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2K1XBD93e-98A0A2K1XBD9_POPTR; Uncharacterized protein
STRINGPOPTR_0016s05890.11e-74(Populus trichocarpa)
STRINGPOPTR_0149s00220.19e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-50homeobox from Arabidopsis thaliana