PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G047900.1
Common NamePOPTR_0016s04830g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 381aa    MW: 43015.8 Da    PI: 7.658
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G047900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.6e-32205259155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt++LH++Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Potri.016G047900.1 205 KTRIRWTQDLHKKFVECVNRLGGAEKATPKAILKLMDSDGLTIFHVKSHLQKYRS 259
                         68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.37202262IPR017930Myb domain
SuperFamilySSF466898.24E-17203259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28203260IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-23205259IPR006447Myb domain, plants
PfamPF002491.6E-8209258IPR001005SANT/Myb domain
PfamPF143792.7E-19289335IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MASRLQPAAV EAGCQNQNIS LERSPDSIMS RFESPASAFY ATERYMRFPQ YDCQVGNYFC  60
SQYSNSYDSH VSSHQSSGAD YINSGEQADH NFGLKSTLES VVKPQFSCHK SFDKSDKGLS  120
SSSGNKLPSE HHNKFLDNPG VSLENHFLVP FQGNQNRQVD YNPYNSPFSE LGRFNSREEK  180
RSPRFSLGGF PISSGKDLST TLSSKTRIRW TQDLHKKFVE CVNRLGGAEK ATPKAILKLM  240
DSDGLTIFHV KSHLQKYRSA RYMPDSSEGK AEKRTSIDDV SQLDVKTGFQ IREALEVQLD  300
VQRRLHEQLE IQKILQLRIE EQGKQLKMMF DQQQKKTNSL LNNQNLNITS PDESTFSLED  360
IDVSIVEGSN NNTHFPSKIS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-23205262259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-23205262259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-23205262259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-23205262259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-23205262259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-23205262259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-23205262259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-23205262259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G047900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322672.10.0myb family transcription factor PHL5 isoform X2
TrEMBLB9II050.0B9II05_POPTR; Uncharacterized protein
STRINGPOPTR_0016s04830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.18e-75G2-like family protein