PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G042900.1
Common NamePOPTR_0016s04220g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 936aa    MW: 104892 Da    PI: 7.3826
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G042900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.79.7e-28617666352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++isle+l++yF++++kdAA++L vc+T+LKriCRq+GI RWP+Rkik++
  Potri.016G042900.1 617 QTISLEVLRQYFAGSLKDAAQSLSVCPTTLKRICRQHGITRWPSRKIKKV 666
                         78**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.496602686IPR003035RWP-RK domain
PfamPF020424.0E-25618666IPR003035RWP-RK domain
SuperFamilySSF542771.08E-18839926No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-20842922No hitNo description
PROSITE profilePS5174521.063842925IPR000270PB1 domain
SMARTSM006661.1E-15842925IPR000270PB1 domain
PfamPF005641.3E-15843922IPR000270PB1 domain
CDDcd064072.35E-31843922No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 936 aa     Download sequence    Send to blast
MDEHSSSSPN STFGIFSGNP MNWDLMDEIL YQGWAENDGE FSFLQQGPSI SNVLYDHPSL  60
YMPFMGSNNL SIASNQQNYQ EETERHCHGN PPLDYPKSME LLQTEPQVED SVDTSTSLLH  120
TTSYRVEAAG LGVEWQMVPR VNPLTSFSVK ERAMQAIRYL KNCIQYKDSL IQIWLPVEKE  180
GKKVLATIDQ PYFVNPSCKS LASYRNVSVA YHFQVEGDAK FSVGFPGRVF LEKLPEWTPD  240
VRLFRSEEYP RRDHAVQHNI RGSLALPLFK QGSETCLGIV EIVTTTEKIT YRPELEDIRK  300
ALKAVDLRSS EDFCSPGVKT CNGLNQVAVP ELSEIVKSVC KTYGLPLALT WALCSRQGKG  360
GRQQFAEKSG ACISTVDSAC FLADRDFSGF HMASFEQYIF LGQGIVGRAF TTQKQCFAND  420
ITSFSKKDYP LAHHAKIFGL HAAIAIPMRS IATGLVEFVL ELFLPIDCKD TEEQKKMWDL  480
LPIAIQQVCW SLQVVMDKGL GNGENQSFES SPSKQPPLDE SSWISRMVEA QKKSKSFCVT  540
WGYPKEPKEE FKMITHWDES AVELDHKQVI SELGQLQQNS RTNSNTEGDG VSSAFGRHLS  600
FGSRKTGKKR RTKTDIQTIS LEVLRQYFAG SLKDAAQSLS VCPTTLKRIC RQHGITRWPS  660
RKIKKVDHSL RKLQQVIDTV QGAKGAIQIE SFYSAFPELS STKLSSHAPS SSFRRSDSSK  720
HFDSPPDDTI FSGTTSKSHS SPCSRSSCSS NCCSARAQQH AATVITGSSN GNGGLPAETS  780
NGVLKRTSSS ELAEFYSLNN EVEPDFLSRS YIHKTRTINE QIHQSLLETP PQFGQSRRGG  840
DVFRVKAIFG VEKVRLFLQP NWGLRELQQE IGKRFKIDDF TGIGLKYMDD DGEWIRLTRD  900
DDLEECKETH KFCQSNTIKL SLYKYSTAFG CRGSC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1607612KKRRTK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G042900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322654.20.0protein NLP2
TrEMBLB9IHW60.0B9IHW6_POPTR; Uncharacterized protein
STRINGPOPTR_0016s04220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein