PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.016G001200.1
Common NamePOPTR_0016s00320g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 315aa    MW: 33886.4 Da    PI: 6.5113
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.016G001200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1054.2e-334397155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LH+rFv+av+qLGG++kAtPk+il++m+vkgLtl h+kSHLQkYRl
  Potri.016G001200.1 43 KPRLRWTADLHQRFVDAVSQLGGPNKATPKAILRTMNVKGLTLFHLKSHLQKYRL 97
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.64340100IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-314098IPR009057Homeodomain-like
SuperFamilySSF466898.6E-174399IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-254398IPR006447Myb domain, plants
PfamPF002496.1E-84596IPR001005SANT/Myb domain
PfamPF143791.7E-15141186IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MLESRGVGIG GMIMEEMHQN QSGIGIGLGM QGGAQVVLTS DPKPRLRWTA DLHQRFVDAV  60
SQLGGPNKAT PKAILRTMNV KGLTLFHLKS HLQKYRLGKQ SGKDMSDTFK DGLSGSYLLE  120
NPCTGNSSLN MTASDVNEGY EVKEALRAQM EVQSKLHLQV EAEKHLHIRL DAERRYLAML  180
ERACKMLADQ FIGAAVIDTD SQKGLGTRTT RIASLDPLGF YSLQTSEVAE VHGPEDVLPG  240
LHHQGADCST ESCLTSNESP GGLNLEGSPA GGKKGMLSLE SATSLIWGET RMGNAEVNAT  300
QVNSYGASLY GIWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-184399157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-184399157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-184399157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-184399157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.39580.0bud
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.016G001200.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006373552.10.0protein PHR1-LIKE 3 isoform X1
SwissprotQ94A575e-60PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLU5FM900.0U5FM90_POPTR; G2-like family protein
STRINGPOPTR_0016s00320.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-61G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]